KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL005187Help
Entry
AaeL_AAEL005187   CDS       T01053                                 

Definition
laminin gamma 1 chain
Orthology
K05635  
laminin, gamma 1
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:aag04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1624 aa AA seqDB search
MKMAIQLPKTIIHYLSVLAILRATTITASDNQHYLPPLECYDPYGRPQRCIPEFENAAYQ
VEIEATNTCGEDGVTNFCVQTGYSNRKSCDDCRENQHAPHFLTDLHDPTNPTWWQSETMF
EGIQYPNQVNLTLNLGKSFDITYIRIVFYSPRPESFAIYKRVTPNGTWTPYQYYSATCRD
TYGLPDSLSVMKGEDESRALCTSEYSDISPLRDGNIAFSSLEGRPSAINFEHSLELQQWV
TATDIRITLDRLNTFGDEVFGDAQVLQSYFYAIADIAVGARCKCNGHASECITSTSNSGQ
RGRVCKCQHYTDGPDCEKCLPFYNDAPWGRATSKNVHECKPCNCNGYSTKCFFDRQLYNL
TGHGGHCIECGANRDGPNCERCKENFYMREDGYCINCGCDSTGSRSLQCNAEGKCQCKPG
VTGEKCDRCENNFYNFGPHGCQPCNCDVRGSFDNTPSCDPNTGICACKENVEGRHCRECR
PGYFNLDLENKFGCTPCFCYGHTSECTSAAGYSIVSTTSNFNKHKEKWTAATASGTAVDI
KYNSKGQTIGVGAQGYEPIYFLAPDRFLGDQRASYNKVLKFRLQLVGQPRPDVSTFDVIL
QGSNSSISLPIFAQNQQMPDDEMKEFSFTLHEHPEYSWQPSMSARGFMSILSNLTAIKIR
AIYSDYGEAFLDDVELQTAHRGAAGRPATWIEQCTCPEGYLGQFCESCAPGYRHNPALGG
PFMPCIPCDCNKHAEICDSETGRCICQHNTAGDTCDQCAKGYYGNALGGTPYDCKRCPCP
NNGACMQMADESVICLECPVGYFGPRCELCSDGYYGDPTGVHGAIRMCQSCDCNGNVDPN
AVGNCNRTTGECLKCIHNTAGVHCDQCLPGHFGDPLALPHGNCEQCSCYPRGTEQTDKGI
SICDPNNGNCQCKPNVIGRNCNECKNGYWNIISGNGCENCNCDPTGSFNSSCNTYTGECY
CKPGVVGKKCDKCAVTHYGFSLEGCNSCDCDPSGSKGSQCDQYGQCPCNDNVEGRRCDRC
KENKYDRHQGCLDCPACYNLVQEAANEHRQKLANLNKILQDIQSKPIVIDDNEFVSKLRA
VQDKIDILVEDAKSGSGGGDKTLNEMLQDLEKRLETVEDLLNKADQSQKTMDLKIGKGTS
NATIANTQIKEARKELDNAIDILQTDGNGALNRARDISGRLGNQTNQISGISREARQYAD
QFKKEADENKKEAEEALDKATKAHNMAKNTINLQSNISEEFRTNISSELQQAKDKLNTVS
KLTEQALTKANEVYDDALSLFVAVNNLSPPSIDIDQIKKESNRYNKEADKINQDLDITIE
DHNTLLIDVSENIELANTLLERAESQKDDAIRAVQELEFARELAEKAVAEGDGTLKKANF
TYHTLSGFKNQVEESKQKAAEALKSVPSIKRQIENAIELIANSEAALKNANINAAESRSN
AQTAQKKYAEEASKLADNIKKRANTTKNTARDLRHEADQLNGRLAKTENSLSERETNIRK
DFNLTKEAKEKVGQAQLNSNEAKTQVDKAMKDIKAIIDELADLRDIDVQSLDALEDRLMA
AEKELEDAQLTNKLHVLNESKNIQSQNIKSYQRELAELETEVANIKMIADSLPEHCYKRT
RLEP
NT seq 4875 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggctatccaattgccaaagacgatcatccactatttatcagtactggcaata
ctaagggcaactacgatcacggcaagtgataatcaacactatctaccaccattggaatgt
tacgatccatacgggagaccgcagcgctgtatacccgagttcgagaatgctgcatatcag
gttgaaatagaggccaccaacacttgtggcgaagatggtgtgactaacttttgtgtgcaa
actggatactccaatcggaagagttgcgatgattgtagagaaaatcaacatgctccacat
tttttgaccgatttacatgatccaaccaaccctacatggtggcaatcagaaacaatgttc
gaaggaatccagtacccaaatcaagtgaatctaacgctaaatcttggaaaatcgtttgac
atcacgtacattcgaattgttttttactcaccgcgtcctgaatcatttgccatttacaag
cgagtaacaccaaatggcacgtggactccatatcaatactacagtgccacatgccgagac
acatatggtcttccagattctctttcggtaatgaagggagaggatgaatctcgtgcatta
tgtactagcgagtacagtgacatttcacccttgcgagatggtaatatagctttctcatcg
cttgaaggaagacccagtgcaataaactttgaacacagcctggaattacagcaatgggta
accgccactgatattcgcataacgctggaccgcttgaacactttcggagatgaagtattt
ggcgatgctcaggtgcttcaatcttacttttatgctatagccgatattgcagttggcgcc
aggtgtaaatgtaacggtcatgcaagtgaatgtatcacaagtaccagcaatagtggtcaa
cgaggacgagtatgtaaatgccaacattataccgatgggccagattgtgaaaaatgttta
cctttttataatgatgcaccatggggacgagccacatcgaagaatgttcatgagtgcaaa
ccgtgcaactgtaacggatattcaacgaaatgtttcttcgatcgtcaactgtataatttg
actggccatggaggacattgtatcgaatgtggtgccaatcgtgatggaccgaattgtgaa
cggtgcaaggagaatttctatatgcgtgaagatggctattgcatcaattgtggttgtgat
tcaacgggatctaggtcactgcaatgtaatgcggaaggaaaatgccagtgcaaacctgga
gtaacgggagaaaagtgcgatcgctgtgaaaataacttttacaatttcggacctcatggt
tgtcaaccttgtaattgcgacgttagaggttccttcgacaatactccatcatgtgatccc
aacactggaatttgtgcttgcaaggaaaatgtagaaggacgtcactgtcgcgagtgccgg
ccgggatacttcaatttggatttggaaaataagtttggatgtactccatgtttctgttat
ggtcataccagtgagtgcacaagtgctgcaggatactcgatagtgtctaccacttctaat
ttcaacaagcataaagaaaagtggacagccgcaactgcaagtggaactgctgtagatatc
aagtacaattcaaaaggacaaactatcggtgtcggtgcgcaaggatatgaaccgatatac
ttcctggctccagaccgttttctcggcgatcaacgagcatcatacaataaggttttgaaa
ttccgacttcaactcgttggacaaccaagaccagatgtgtctacgtttgatgtcatacta
caaggatcaaacagtagtatatcgctgccaatatttgcacaaaatcaacaaatgcctgat
gacgagatgaaagaattttccttcacgcttcatgaacatcctgaatattcttggcagcca
tctatgtcagctagagggtttatgtctatactgagcaacctcactgccattaaaataaga
gctatttactccgactatggcgaagcatttttggatgatgttgaattgcaaactgcacat
cgaggagcagctgggcggccagcaacttggattgaacaatgcacatgtccagaaggctat
ttgggtcaattttgcgaatcatgtgcgccaggttatagacacaaccccgctctgggtgga
ccatttatgccttgcataccttgcgattgcaataaacatgcagagatatgcgattctgaa
actggacgttgtatatgccaacataatactgcaggtgatacgtgcgatcagtgtgcaaag
ggatattatggtaacgctttaggaggaactccttatgattgtaaacgttgcccttgtcca
aataatggagcatgtatgcaaatggcagacgaatcagtgatatgcttggaatgcccagtt
ggatactttggccctcgatgtgaactatgttccgatggctattatggagatccaaccggt
gtccacggtgccattcgaatgtgccaatcatgcgattgtaatggcaatgttgatccaaac
gcagtcggtaattgtaatcgcactactggtgaatgcttaaagtgtattcacaatacagct
ggcgtccactgcgaccaatgtttaccaggtcactttggagatccactggcattacctcac
ggtaactgtgaacaatgtagttgctatcctagaggcaccgaacaaacggacaagggcatt
tccatctgtgatcccaataatggaaattgtcaatgcaagcctaacgtaattggtcgtaat
tgtaacgagtgcaagaatggttactggaacataatatctggaaacggttgtgaaaattgc
aattgtgatccaacgggaagcttcaattcatcatgcaatacatacactggagaatgctat
tgcaagccaggagttgtcggcaaaaaatgcgacaaatgtgcagtaacacattatggattt
tcactagaaggatgtaactcttgtgactgtgacccaagcggttcgaagggttcccaatgc
gatcaatatggacagtgcccatgtaatgacaatgtcgaaggtagacgttgtgatcgttgt
aaagagaacaagtatgatcgccatcaaggttgtctcgattgtccagcgtgctacaactta
gtgcaagaagcagcaaacgaacaccgtcaaaagttggctaacttgaacaaaattttacaa
gacatccaatccaaaccaattgtaatagatgataacgaatttgtatcgaaactaagagcc
gttcaagataaaattgatattttagtagaagatgcaaagagtggttctggtggaggagat
aagacactaaatgagatgttgcaagatttagagaaacgtttagaaactgttgaagattta
ctcaacaaggcagatcaatctcaaaaaacgatggatttgaaaataggcaaaggaaccagc
aatgcaacaatagcaaacactcaaataaaagaggctcgtaaggaacttgataacgcaatc
gacatattacaaactgatggaaatggagccttaaatagagctcgagatatttcaggccga
ctgggtaatcaaaccaaccaaattagtggaatttctcgagaagcccgacaatacgcagat
cagtttaaaaaagaagccgatgaaaataaaaaagaagctgaagaggctcttgataaggcc
actaaggctcataatatggccaaaaatacaattaacttacagtctaacataagcgaagaa
ttccgaacgaatatttcttctgaattacaacaagctaaagacaaacttaatacagtgtca
aagttaacagaacaagcattaacaaaagcaaatgaagtgtatgatgatgctctatccctt
ttcgtggcagtgaacaatttatctcctcccagcattgatattgaccagatcaaaaaagag
tccaacagatacaacaaagaagcagataaaatcaatcaagatttagatataactatagaa
gatcacaacactctattaatcgacgtcagcgaaaacatagagcttgcaaacacgctactt
gaaagagctgagtcgcagaaggatgatgcgatcagagccgtccaagagttggaattcgca
agagaattagcggagaaagctgtagcagaaggggatggaacccttaagaaagccaacttt
acctaccacacactctctgggttcaaaaatcaagttgaagaatcgaaacaaaaagccgca
gaagccctcaaatctgtgcccagtattaaaagacaaatagaaaacgctattgaactgatt
gccaattcagaagcagcattgaaaaacgccaacataaacgctgcggaatctcgtagtaat
gcgcaaaccgctcagaaaaaatacgccgaagaagcatctaagctcgctgacaacatcaaa
aagagagccaacacaacgaaaaatactgctcgagatttgaggcatgaagccgaccaattg
aatggccgattagctaaaactgagaacagtctatccgaacgagaaacgaatattcgtaag
gatttcaaccttacgaaagaggctaaggaaaaagttggacaagctcagctcaactcaaac
gaagcaaaaacgcaagtcgataaagctatgaaagatatcaaggctataattgatgaactg
gctgatttacgcgacattgacgttcaaagtctggatgcgttagaggaccgtttgatggcg
gctgagaaagagttggaggatgcacagcttacaaacaagttacacgtgctaaacgagtcg
aaaaacattcagtcacaaaacatcaaaagttatcaacgcgaattagcagaactggaaacc
gaagtggcaaatatcaaaatgattgcagactctttacctgaacattgttacaaaagaaca
cgactcgagccataa

DBGET integrated database retrieval system