KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL005188Help
Entry
AaeL_AAEL005188   CDS       T01053                                 

Definition
alpha-galactosidase/alpha-n-acetylgalactosaminidase
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AaeL_AAEL005188
  Lipid metabolism
   00561 Glycerolipid metabolism
    AaeL_AAEL005188
   00600 Sphingolipid metabolism
    AaeL_AAEL005188
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    AaeL_AAEL005188
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AaeL_AAEL005188
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AaeL_AAEL005188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 426 aa AA seqDB search
MKTLWIVLAVSVSVAYGLENGLARTPPMGWMSWERFRCITDCTKYPDECISEQLFKRMAD
LMVSEGYLQAGYNFVNIDDCWSEMKRDSSGRLVPDKKRFPNGIKHLADYIHSKGLKFGLY
QDIGTKTCAGYPGMKDYFEVDAQTFADWDVDFIKIDGCYADERKMVDDYILFGDLMNKTG
RPILYSCSWPVYQEYNGIIPDYEILKKTCNMWRNWGDIDDSHSSVESITRYFSDNQARIQ
PHSGPGHWNDPDTLVLGNFGLSYEQSKSQLAVWTVLAAPLLLSNDLATVTPEIRELLLNK
EIIAANQDPLGIQGLLVKTINRIEIWKRPILPKVKDEMTQVVAFVSRRADGAPYAVRVKL
VEDLGISDNSYIKGYKVYDLFNKDRKPTFVPANGTFETRINPTGANFYRFEPKLNVALRG
MTEWNY
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttatggatagtgttggcagtgtcggttagtgtggcttatggacttgaaaat
ggactggctcgaacccctccgatgggttggatgagttgggagcgattccggtgcattact
gattgtacgaaatatcctgatgagtgcatcagtgaacagttgtttaagcgtatggccgac
ttgatggtgtcggagggatatctgcaggccggatacaactttgtgaacatcgacgattgt
tggtcagagatgaaacgagactccagtgggcgattggtgcctgataagaagcggtttccc
aacggaattaagcatttagcagactacattcattccaaaggactgaaatttggtctgtac
caagacattggtacaaaaacttgtgctggatacccgggtatgaaggattactttgaagtg
gatgcgcaaaccttcgctgattgggatgtcgatttcattaaaattgacggttgctacgcc
gatgaacgtaaaatggtggatgactatatattgtttggtgatcttatgaataaaactgga
agacctattctatattcatgcagctggcccgtttaccaggaatacaatggaataattcca
gattatgagatactgaaaaagacttgcaatatgtggcgcaattggggcgatatcgatgac
tctcacagctccgtagaatccattacacgctacttctcagacaaccaagcgcgcatacaa
ccccattctggtcctggccattggaatgatccagacactcttgtcctaggaaactttggc
ctcagctacgaacaaagcaaatcgcaattagcagtgtggacggtccttgctgcgcctctg
ctattgtccaacgatctggcaacggttactccggagatcagagaacttctgctgaacaaa
gaaatcatagcggccaaccaagaccctcttggcattcaaggtctgctggtaaaaactatt
aacagaatcgagatatggaaacgaccgatactccccaaggtgaaggatgaaatgacgcaa
gtcgtggctttcgtcagccgccgcgccgatggagcaccatatgccgttcgagtgaagctc
gtcgaagatcttggcatcagtgataacagttacatcaaaggatataaggtttacgatttg
ttcaacaaagatcgcaaaccaacatttgtaccagcgaatggaacattcgaaacgcgaatc
aaccccactggagccaatttctatcgatttgaaccgaaattgaatgtcgccctaagaggc
atgaccgagtggaattattaa

DBGET integrated database retrieval system