KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL005188Help
Entry
AaeL_AAEL005188   CDS       T01053                                 

Definition
alpha-galactosidase/alpha-n-acetylgalactosaminidase
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aag00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aag00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aag00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:aag00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aag04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 426 aa AA seqDB search
MKTLWIVLAVSVSVAYGLENGLARTPPMGWMSWERFRCITDCTKYPDECISEQLFKRMAD
LMVSEGYLQAGYNFVNIDDCWSEMKRDSSGRLVPDKKRFPNGIKHLADYIHSKGLKFGLY
QDIGTKTCAGYPGMKDYFEVDAQTFADWDVDFIKIDGCYADERKMVDDYILFGDLMNKTG
RPILYSCSWPVYQEYNGIIPDYEILKKTCNMWRNWGDIDDSHSSVESITRYFSDNQARIQ
PHSGPGHWNDPDTLVLGNFGLSYEQSKSQLAVWTVLAAPLLLSNDLATVTPEIRELLLNK
EIIAANQDPLGIQGLLVKTINRIEIWKRPILPKVKDEMTQVVAFVSRRADGAPYAVRVKL
VEDLGISDNSYIKGYKVYDLFNKDRKPTFVPANGTFETRINPTGANFYRFEPKLNVALRG
MTEWNY
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttatggatagtgttggcagtgtcggttagtgtggcttatggacttgaaaat
ggactggctcgaacccctccgatgggttggatgagttgggagcgattccggtgcattact
gattgtacgaaatatcctgatgagtgcatcagtgaacagttgtttaagcgtatggccgac
ttgatggtgtcggagggatatctgcaggccggatacaactttgtgaacatcgacgattgt
tggtcagagatgaaacgagactccagtgggcgattggtgcctgataagaagcggtttccc
aacggaattaagcatttagcagactacattcattccaaaggactgaaatttggtctgtac
caagacattggtacaaaaacttgtgctggatacccgggtatgaaggattactttgaagtg
gatgcgcaaaccttcgctgattgggatgtcgatttcattaaaattgacggttgctacgcc
gatgaacgtaaaatggtggatgactatatattgtttggtgatcttatgaataaaactgga
agacctattctatattcatgcagctggcccgtttaccaggaatacaatggaataattcca
gattatgagatactgaaaaagacttgcaatatgtggcgcaattggggcgatatcgatgac
tctcacagctccgtagaatccattacacgctacttctcagacaaccaagcgcgcatacaa
ccccattctggtcctggccattggaatgatccagacactcttgtcctaggaaactttggc
ctcagctacgaacaaagcaaatcgcaattagcagtgtggacggtccttgctgcgcctctg
ctattgtccaacgatctggcaacggttactccggagatcagagaacttctgctgaacaaa
gaaatcatagcggccaaccaagaccctcttggcattcaaggtctgctggtaaaaactatt
aacagaatcgagatatggaaacgaccgatactccccaaggtgaaggatgaaatgacgcaa
gtcgtggctttcgtcagccgccgcgccgatggagcaccatatgccgttcgagtgaagctc
gtcgaagatcttggcatcagtgataacagttacatcaaaggatataaggtttacgatttg
ttcaacaaagatcgcaaaccaacatttgtaccagcgaatggaacattcgaaacgcgaatc
aaccccactggagccaatttctatcgatttgaaccgaaattgaatgtcgccctaagaggc
atgaccgagtggaattattaa

DBGET integrated database retrieval system