KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL005617Help
Entry
AaeL_AAEL005617   CDS       T01053                                 

Definition
utp-glucose-1-phosphate uridylyltransferase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AaeL_AAEL005617
   00052 Galactose metabolism
    AaeL_AAEL005617
   00500 Starch and sucrose metabolism
    AaeL_AAEL005617
   00520 Amino sugar and nucleotide sugar metabolism
    AaeL_AAEL005617
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AaeL_AAEL005617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MTGAIDILLKVRGHQRVPSDTKEFHEATKRDALLRLRKDLDNLLQTADDAKKTILQKEMC
GFEALFHRFLQEDGPSVEWDRIQKLPQDAVKDYSSLKTPQESEIREMLNKLVVIKLNGGL
GTSMGCHGPKSVIPVRNDLTFLDLTVQQIEHLNKTYGATVPLVLMNSFNTDDDTEKVIRK
YKGFQVQIYTFNQSCYPRISRDSLLPVAKDFTIENDIEAWYPPGHGDFYQSFQNSGLLKK
FLAEGREYCFLSNIDNLGATVDINILNRLLGDDRQGDKPIEFVMEVTDKTRADVKGGTLI
HYENKLRLLEIAQVPKEHVDDFKSVKTFKFFNTNNIWARLESIERVLDAHTMNMEIIVNN
KTLDNGMRVIQLETAVGAAMKCFDGGIGINVPRSRFLPVKKTSDLLLVMSNLYSLKYGSL
VMSPQRMFPTTPLVKLGDNHFSKVKEFLGRFANIPDLIELDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtgccatcgatattctactgaaagtccgcggacatcaacgcgtgccttcggac
acgaaagaatttcacgaagccactaaacgtgacgcgttgcttcggctacgcaaggatcta
gacaatcttctacaaacagctgacgatgccaagaaaacgattctacagaaagaaatgtgc
ggctttgaagccctctttcatcggttcctgcaggaagacggtccctcggtagaatgggac
cgcatccaaaaactaccgcaagatgcggtcaaagattattctagtctgaaaacgccccag
gaatcggaaatccgtgaaatgctgaacaaattggtcgtaatcaagttgaatggtggtttg
ggtacttcgatgggttgtcacgggcccaagagcgtgattcccgttcgtaacgatctcaca
ttcctggatttgaccgtgcaacagatcgaacatttgaacaaaacctatggcgccaccgta
cctttggtgttgatgaattctttcaataccgacgacgacacagagaaggtcattcgcaag
tacaagggattccaggtgcagatttacaccttcaatcaaagttgctatccgcggattagt
cgtgattctttgttgccggtggcaaaggatttcaccatagaaaacgacattgaagcgtgg
tacccgccaggtcacggagatttttatcagtcgttccaaaactcgggattgctgaaaaaa
ttcctcgcagaaggacgcgaatactgcttcctgtccaatatcgacaatttgggcgcgacg
gtcgatatcaacattttgaatcgtttactgggcgatgaccgtcaaggtgacaagcccatt
gaattcgtcatggaggtcaccgataaaacccgagcagacgttaagggtggtaccctgatt
cactacgagaacaagttgcggttgctggaaattgctcaggttcccaaggaacatgtggat
gattttaagtcggttaagacattcaaatttttcaacactaacaatatctgggcacgttta
gagtctatagaacgagtgttggatgcgcacactatgaacatggaaatcattgttaacaac
aaaacgttggataatggcatgcgagtgattcaactggagactgctgtgggtgctgccatg
aaatgctttgacggtggcatcggaatcaatgtacctcggtcacgtttcttgcccgtcaag
aaaacttccgatctgctgttggttatgtcgaacctgtacagtctgaaatacggatcgcta
gtcatgtcgccacaacgtatgttcccaaccacacctctagttaaactgggtgataaccat
tttagcaaagtcaaggaattcctcggacgtttcgctaatattcctgacttgatcgaacta
gaccatttgacggtatccggagatgtaactttcggtcgtggcgtatcgctccgaggcacc
gttatcattattgccaatcatggtgatcgtatagatatcccggcaggagccattctagag
aacaaaattgtgtccggtaatatgcgcattctcgatcactaa

DBGET integrated database retrieval system