KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL005796Help
Entry
AaeL_AAEL005796   CDS       T01053                                 

Definition
eukaryotic translation initiation factor 4e type
Orthology
K03259  
translation initiation factor 4E
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL005796
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AaeL_AAEL005796
Translation factors [BR:aag03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AaeL_AAEL005796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 204 aa AA seqDB search
MTNKLKPYGSDSDDSGDEGADFDVDKLEPLEVGPGEHKLQYTYCLWFAKKGSHRPAEYGK
SLHFVGRCASVEQWWTLYCHLVKPTMLTSFRKLHLFKSGIKPMWEDPGNVRGGKWVIRLR
KNKVDRAWENVCMAMLGEQFLVGPEICGVVLSTQFPEDLLSIWNRTATDTTSTNRIRDTL
RRILNLAPSTHMEYKPHCDSLKYL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgactaacaagttgaaaccctatggaagcgacagtgacgatagtggtgatgaaggcgca
gactttgacgtggacaagttggaacctctggaagtaggccccggggaacacaagctccag
tatacgtactgtctttggttcgcgaaaaaaggttctcacagacctgcggagtacggcaaa
tcgctacactttgtgggacggtgcgccagtgtggaacagtggtggacattgtattgccat
ttagttaagcctaccatgttgacatccttccgaaagttacatttattcaagagtggcata
aaacccatgtgggaagacccaggaaatgtgcgcggcggcaaatgggtcattcggttgaga
aagaacaaagttgatcgagcgtgggaaaatgtctgcatggcaatgctcggagagcagttc
ttggtcggtccagaaatatgtggtgtcgtactttcgacgcaattcccggaggatctgctg
tccatctggaaccgaactgccacagacacaaccagcaccaatcgaatccgggacacgtta
cggagaattctgaacctggccccttcgacacacatggagtataaaccacactgcgatagt
ctcaagtacctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system