KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL006070Help
Entry
AaeL_AAEL006070   CDS       T01053                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:aag01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aag01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aag00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aag00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 255 aa AA seqDB search
MAGKYRIVMVRHGESEWNQKNLFCGWFDANLSDKGKEEALAAGKAIKEAGLKFDVAHTSL
LTRAQVTLNSILTESGQTGIPIEKTWRLNERHYGGLTGLNKSETAAKYGEEQVLIWRRSF
DVPPPNMEPDHAYYDAIVKDERYKGDPKPEEFPMAESLKLTIARTLPYWNDVIIPQIKAG
KNIIIAAHGNSLRGIVKHLDQMTDEAIMGLNLPTGIPFVYELDENMKPVVSMKFLGDEET
VRKAIESVANQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaaataccgtatcgtaatggtccgccacggcgaatccgagtggaaccagaag
aatctcttctgcggttggtttgatgccaaccttagcgataagggtaaggaggaagcgttg
gccgccggaaaggccatcaaggaagccggattgaaatttgatgtggcccacacttctctg
ttgacccgcgcccaggtcaccttgaactcgattctaaccgaatctggtcaaaccgggatc
ccgattgaaaagacctggcgtttgaatgagcgtcattatggtggcctaacgggattgaac
aaatccgaaactgctgccaagtacggagaggaacaggttctgatctggcgacgaagcttc
gatgttccgccgccaaacatggaaccggatcatgcctattacgatgccattgtgaaggac
gaacgctacaagggagacccgaagccggaagagttccccatggctgaatcgttgaaactg
accattgcgcgtacgctgccctattggaacgacgttatcattccccaaatcaaagcagga
aagaacatcatcatcgctgcccacggaaacagtctgcgcggtatcgttaagcatctggac
cagatgaccgatgaggccatcatgggactgaatctccccaccggtattccgttcgtgtac
gaattggatgagaacatgaagccggtcgtttcgatgaaattccttggcgatgaggaaact
gttcgcaaggccatcgaatccgtcgctaatcagggtaaggctaagtag

DBGET integrated database retrieval system