KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL006070Help
Entry
AaeL_AAEL006070   CDS       T01053                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AaeL_AAEL006070
   01230 Biosynthesis of amino acids
    AaeL_AAEL006070
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AaeL_AAEL006070
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AaeL_AAEL006070
Enzymes [BR:aag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AaeL_AAEL006070
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AaeL_AAEL006070
  Exosomal proteins of melanoma cells
   AaeL_AAEL006070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 255 aa AA seqDB search
MAGKYRIVMVRHGESEWNQKNLFCGWFDANLSDKGKEEALAAGKAIKEAGLKFDVAHTSL
LTRAQVTLNSILTESGQTGIPIEKTWRLNERHYGGLTGLNKSETAAKYGEEQVLIWRRSF
DVPPPNMEPDHAYYDAIVKDERYKGDPKPEEFPMAESLKLTIARTLPYWNDVIIPQIKAG
KNIIIAAHGNSLRGIVKHLDQMTDEAIMGLNLPTGIPFVYELDENMKPVVSMKFLGDEET
VRKAIESVANQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaaataccgtatcgtaatggtccgccacggcgaatccgagtggaaccagaag
aatctcttctgcggttggtttgatgccaaccttagcgataagggtaaggaggaagcgttg
gccgccggaaaggccatcaaggaagccggattgaaatttgatgtggcccacacttctctg
ttgacccgcgcccaggtcaccttgaactcgattctaaccgaatctggtcaaaccgggatc
ccgattgaaaagacctggcgtttgaatgagcgtcattatggtggcctaacgggattgaac
aaatccgaaactgctgccaagtacggagaggaacaggttctgatctggcgacgaagcttc
gatgttccgccgccaaacatggaaccggatcatgcctattacgatgccattgtgaaggac
gaacgctacaagggagacccgaagccggaagagttccccatggctgaatcgttgaaactg
accattgcgcgtacgctgccctattggaacgacgttatcattccccaaatcaaagcagga
aagaacatcatcatcgctgcccacggaaacagtctgcgcggtatcgttaagcatctggac
cagatgaccgatgaggccatcatgggactgaatctccccaccggtattccgttcgtgtac
gaattggatgagaacatgaagccggtcgtttcgatgaaattccttggcgatgaggaaact
gttcgcaaggccatcgaatccgtcgctaatcagggtaaggctaagtag

DBGET integrated database retrieval system