KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL006177Help
Entry
AaeL_AAEL006177   CDS       T01053                                 

Definition
histone acetyltransferase type b catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AaeL_AAEL006177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 410 aa AA seqDB search
MTAISSLQNFVTDALECTQFRLIRDDADFEDESVAFHPEMAHQIFGEQESIFGYRDLQID
VCFAASSLDIYFNIKYSKKVDEVCSEGVKPDDVEKALAEIVEDGCYYTNLEEYKKVVKAK
TESFKPFGEKVDEFQISSGTADGGTRTFEVYVSDVNDKEFLKFHSRLESFSFWFIDAFSR
VEHDPLWLFFMVYEKYSNNNNETRYATAGYFTVYQYFSYPQFIRPRVSQILVLPPFQKLG
IASRLIEETVFKYFVPKENVADITYEQPTDIVQHIRSVSDAKRCMTLPSFAKEHLLAGFS
KSMLRDAKEKFKINPKQCRVIYEILRLGVTDLKNETEYRKYRVEVKKRLNLNDSKNRREL
MRLQKKGVDVSGAFSILPSLEDRIEQLHAAYKEVEKVYHQVLKKINSIRE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctatttccagtttgcagaattttgtcaccgacgccctcgagtgcacccagttc
cgattgattcgggatgatgctgactttgaggacgaatcggtcgcgttccacccggagatg
gctcatcagatattcggggaacaggaaagcatcttcggataccgggatctgcagatcgat
gtgtgcttcgcggccagttcgctagatatttatttcaacatcaaatactcgaagaaggtt
gatgaggtatgttccgaaggagttaagcccgacgacgttgaaaaggctctggccgaaata
gtagaagatggctgctattacaccaacctggaagagtacaagaaagtggttaaagctaaa
accgaatcgttcaaaccattcggcgagaaggtcgatgagttccaaataagttccggaact
gcggacggcggaactcgaacctttgaagtgtacgtgagtgacgtgaatgacaaggaattc
ctaaagttccactcccgtctagagtcgttctcgttctggttcatcgatgctttcagccgg
gtggaacacgaccctttgtggttgttcttcatggtctacgagaaatattcgaacaacaat
aacgaaactcgttatgctacggctgggtattttaccgtttatcagtatttctcgtatccg
caattcattaggccacgcgtcagccaaattctggtgctgcctccattccaaaagctgggc
atcgcttctcggttgatcgaagagacagtgttcaaatactttgtccctaaagagaacgtt
gccgatatcacttacgaacagccgaccgatatcgtccagcatattcgatctgtgtccgat
gccaagcgctgtatgacgcttccatcgtttgccaaggagcatctgctggctggcttttcg
aagagtatgctcagagacgccaaggaaaagttcaaaatcaatcccaaacagtgccgggtt
atctatgagattcttcggttgggagtcaccgatcttaagaatgaaaccgagtaccgcaag
taccgggtagaggtgaagaaacgactgaatctgaacgacagtaagaaccgtcgtgagctg
atgcggctgcagaagaagggagtggatgtaagtggagcttttagtatccttccgtcgctt
gaggacagaatagagcagctgcacgctgcttacaaggaagtggaaaaagtataccaccag
gtgttgaagaagataaattctattcgcgagtaa

DBGET integrated database retrieval system