KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL006356Help
Entry
AaeL_AAEL006356   CDS       T01053                                 

Definition
TFIIH basal transcription factor complex p52 subunit
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AaeL_AAEL006356
  Replication and repair
   03420 Nucleotide excision repair
    AaeL_AAEL006356
Transcription machinery [BR:aag03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AaeL_AAEL006356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 487 aa AA seqDB search
MSAEAKSSKSTTSSLISKPANLECKNLEEYLKSRPPDALEKLYNYPAICLAVYRELPEIA
RQFVIRILFVEQAIPQAVVSSWGSQVYAKENVLVSRVLTELGVWRTAGLTGGLEAWELCP
TFKKNLKIALLGGGRPWSMSNALDPDQKSRDIEFLDAYAMSRWRCVLHYMVGAGSSKGME
GEGISPDAVRILLHANLMKRDETDGSPVITRQGFQFLLLDTQAQVWHFMLQYLDTCEARG
LDLAECLSMLFQLSFSTLGRDYSSEGLSQGLLTFLQHLREFGLVYQRKRKEGRFYPTRLA
HNITSKNAVQTIQEDGSSVQDKGYIIVETNYRVYAYTDSNLQVALLGLFTELLYRFPNLV
VGVLTRDSVRQAFRGGITAEQIISYLEQHAHPTMLNMEQAINSKSPLPPTVVDQIKLWEN
ERNRFTYTEGVVYNQFLSQGDFNTLRDYAQSIGVMTWQNERTRTMVVTKNGHDDVKRFWK
RYSKGGS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgaggccaaaagctccaagagcacaacgtcctcgctaatcagcaaaccggcc
aacctcgaatgcaagaacctggaggaatatctgaaatctcgaccgccggatgccctggaa
aagctgtacaactatccggctatatgcttggccgtgtatcgagagcttcccgaaatcgca
cgacaatttgtgatacgtattttgtttgttgaacaagcaattcctcaggctgtggtgtct
tcctgggggtcacaggtgtatgccaaggagaacgttcttgtgtcgcgcgtgctaaccgag
ttgggcgtgtggcgcactgccggtttaactggaggactggaagcatgggaactgtgtcct
actttcaaaaagaatttgaagattgccctgctgggtgggggtcgtccatggtcgatgtcc
aatgccttggatccggatcaaaagtccagagatattgaattcctcgacgcgtatgccatg
tcccgttggcgatgcgtgttgcattatatggtgggagctggaagttccaaaggaatggaa
ggcgaaggaatttcaccggatgccgttaggattcttctacacgcgaatctaatgaaacga
gatgaaacagacggaagtccagtgattacacgacaagggttccagttcctgttgctcgat
acacaagctcaggtgtggcacttcatgctccagtatttggacacctgcgaggctcgtggc
ctagatttggcggaatgcctttccatgttgttccagttgagcttttccacactgggacgt
gactacagttcagaaggcttgagtcagggtctgctaactttcctgcagcatttgcgagag
tttgggctggtataccaacgcaaaagaaaagaaggtagattctacccgactagattggcg
cacaacatcacttcgaagaatgcagtccaaaccattcaggaagatggaagctctgtccag
gacaaaggatacatcattgtggaaaccaattaccgcgtgtacgcatacactgattcgaat
ctgcaggtagccttgctcggtttgttcaccgaactgttatatcgctttccaaatttggtg
gttggtgttctcaccagagattcagttcggcaagcttttcgaggaggcatcactgccgaa
caaataataagctatttggagcaacatgcacatccaacgatgctgaacatggaacaagca
atcaactcaaaatcgcctctgccgccgaccgttgtcgatcagatcaaactgtgggagaac
gagcggaatcggttcacctatacggaaggagtagtgtacaaccagttcctgtcccagggc
gatttcaacaccttgagagattacgcccaatcgatcggagtgatgacctggcagaacgaa
cgaacacgcacgatggttgtcacgaaaaatggccacgacgatgtgaagcggttctggaaa
cgttactccaagggtggcagttag

DBGET integrated database retrieval system