KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL006370Help
Entry
AaeL_AAEL006370   CDS       T01053                                 

Definition
amsh
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aag00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AaeL_AAEL006370
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AaeL_AAEL006370
Peptidases [BR:aag01002]
 Metallo Peptidases
  Family M67
   AaeL_AAEL006370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 405 aa AA seqDB search
MSVRKDLVTAESAQMGIVEPQERLKQLASMSNSVEVDPNIPITRYYRSGLEMVRMANVYL
QEGNIDAAYILYIRFITLFVEKVPIHPEYKTVAADVKMQNKKKLKEVFPLTEKLKLKLKA
KYTKEYQQFLEAKRLEKELEEKRLREEKEQRAKAASITPPINLPQPSAPSLPPSMLVDPD
MLDRVLYPNDFPTDPNRSSSGTGLLLPDTKPFPKPAFDRTLKPSPTSVQAGSLRSVVVPT
NTMAKFLALASHNTLSNVETCGILAGRLAQNKLLITHVIVPKQRGTSDSCTTMNEEDIFN
YQDQHNLITLGWIHTHPSQTAFLSSVDLHTHCSYQMMLEEAIAIVCSPKYQETGFFCLTP
NYGLDYISQCRLTGFHPHPKDPPLFMEALHIALEDSAKIEVVDLR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaagaaaggatctcgtgaccgccgaatcggcccagatgggaattgtggaaccc
caggagcgtctgaagcagctggcttcgatgagcaacagcgttgaagtagatccaaatatt
ccgatcacgagatattaccggtcgggcctagaaatggtacgcatggccaatgtttacctg
caagagggaaacatcgatgctgcctatatattgtacattaggtttataactttgtttgtg
gagaaagttccgatccaccccgagtacaaaacggttgcggctgatgtaaaaatgcagaac
aagaaaaaattgaaggaagtttttccacttaccgaaaagctaaagctgaaactgaaggca
aagtacaccaaagaataccagcagtttctggaagcgaagcgattggagaaggaactcgaa
gagaagcgattacgagaggaaaaagaacaacgagccaaagcagcgtccattacaccgcct
attaaccttccgcaaccgagtgctccttcattgcccccatccatgctcgtggatccagat
atgctggaccgtgtgctctatccaaatgatttcccaacggatcccaatcgctcgtcgtcg
ggtaccggtttgctactgccggacacgaaaccatttccaaagccagcattcgaccgaacg
cttaaaccttcgcccacttcggtgcaggccggaagtctccgatcggtggtagtccccacc
aacacgatggccaaattccttgcccttgcttcgcacaatacgctgagcaatgtggaaacc
tgtggcatcctggcggggcgactggctcaaaataagctccttataacgcatgtcatcgtt
cctaaacagcgcggaacctcggacagctgcacgacgatgaacgaagaagacatcttcaac
taccaggatcagcacaatctgatcacgctcggatggatccacacgcatcccagtcagacg
gcgtttttgtcttcagtggatttgcacacgcactgttcctaccagatgatgctggaggaa
gcgatcgcaatcgtatgttcgcccaagtatcaagaaactggatttttctgtttgacgccc
aactacggattagactacatttcgcagtgtcgactgacgggattccatcctcatcctaaa
gatcctccattgttcatggaagcactgcacatcgcgttggaggatagcgccaaaattgaa
gtggttgacttgcggtaa

DBGET integrated database retrieval system