KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL006553Help
Entry
AaeL_AAEL006553   CDS       T01053                                 

Definition
protein disulfide isomerase, putative
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AaeL_AAEL006553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 424 aa AA seqDB search
MCPNILQFVLGASSAVDGSRVLELSDRFLDVRNEGQWFVMFYAPWCAHCKKLEPVWAHVA
QALFNTNIRVGRVDCTRFTAVAQAFKVNAYPTILFIKGPYDYAYNGDRTKDELIHFVNRL
SGPPVQQVTRPDSIDILKSNNPIFFTYVGKQDGILWDIFYSAAEVYQPHSYFYATSVEIA
KRHFDIDTVPAALVYKERSHFYFPYSDNFELIEPVHLNESLFRWVNEERFPTFPKVTRSN
IHHILQTKKYLVLAVVEENKLSEIAAHEQEFRDMVEIFVHKNKHKYHSRFQFGWVGTPDL
AHSIAMDKLATPHLIVLNASTNEHHIPEDDPLQLTPEAIELFLDSIHNQTAPAFGGNSLP
VRIYRAWFEAKHSLYEMWMGNPVLTSVLFGLPLGFLSLILYSICCADILDAEEEEEEPKH
EKKE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcccaacatactacaattcgtgttaggtgctagttcagcagtggacggttctcgg
gtgttggaactaagcgaccgctttctggatgtccgaaacgagggccagtggtttgtgatg
ttctatgctccttggtgcgcccactgcaagaaactggaaccggtgtgggctcacgtcgcg
caagctctcttcaatacgaatatccgagttgggagggtggattgcactcggttcactgcc
gtggcccaggccttcaaagtcaatgcctatccaacgattttattcataaaaggtccttac
gattacgcctataacggtgatcgaacaaaagatgaactgatacacttcgtgaatagatta
tctggaccaccagttcagcaggtcacccgaccggacagtatcgacattctgaaatccaac
aatcccatattcttcacctatgtcggcaaacaagatggaattctatgggatattttctac
agtgcagcggaagtctatcaaccgcatagttatttctacgcaacttcagtggagatagcc
aagagacatttcgacatcgataccgtaccagcggccttagtctacaaagaacgaagtcac
ttctacttcccatactcggacaacttcgagttgatcgaacctgttcacctgaacgaatcc
ctgttcagatgggtcaatgaagagcggttcccgacattcccgaaggttacccggagcaat
atacaccacatcctacaaaccaagaagtacctcgtgctggccgtggtggaagagaacaag
ctgagcgagattgccgcccatgagcaggagttccgcgatatggtggagatattcgtccac
aagaacaaacacaagtatcacagtcgcttccagttcggttgggtgggaacgcctgatctg
gcacattccatagccatggataaactggccacgccgcatttgatagtgctgaatgctagc
accaacgagcaccacataccggaggatgatcctctgcagctgaccccggaggcaatcgag
ctgttcttggatagtattcataaccagacggctccggccttcggcggaaactcgcttccg
gtgcggatctatcgggcctggttcgaagccaagcactcgctgtacgagatgtggatgggc
aatccggtgctgacctcggtcctgttcggccttcccttgggcttcctctcgttgatactg
tactcgatctgctgtgcggacatcctggacgccgaggaagaagaggaggaacccaaacac
gaaaagaaggagtaa

DBGET integrated database retrieval system