KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL006895Help
Entry
AaeL_AAEL006895   CDS       T01053                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AaeL_AAEL006895
   01230 Biosynthesis of amino acids
    AaeL_AAEL006895
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AaeL_AAEL006895
   00030 Pentose phosphate pathway
    AaeL_AAEL006895
   00051 Fructose and mannose metabolism
    AaeL_AAEL006895
   00052 Galactose metabolism
    AaeL_AAEL006895
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AaeL_AAEL006895
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AaeL_AAEL006895
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AaeL_AAEL006895
Messenger RNA biogenesis [BR:aag03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AaeL_AAEL006895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 790 aa AA seqDB search
MAPLAPVQRFIQHGAHKGKGIAVFTSGGDSQGMNAAVRAVVRMGIYVGCKVYFIREGYQG
MVDGGDNIVEANWASVSSIIHRGGTVIGSARCMDFKERAGRLKAALNLVTRGITNLVVIG
GDGSLTGANLFRQEWSSLLDELLSTGKITQDQRTKNKSLHIAGMVGSIDNDFCGTDMTIG
TDSALHRIIEAIDAIVSTAYSHQRTFIMEVMGRHCGYLAVVAGLCIEADYIFIPEDPPKP
DWPERMCRQLNQERSAGQRLNIIIVSEGAIDREGQPITAEKVKQVVVDKLHQDTRITVLG
HVQRGGNPSAFDRVLGCRMGAEAVLALMEADDKTEPCVVSLDGNQAVRVPLMECVQRTKA
VAQAMADKNWEMAVELRGRSFARNLETYKMLTRLKPPKEAFDSQGRGVGGYTMAVMHIGA
PACGMNAAVRSFVRNCIYRGDSVMGIHDGIEGLVAGNIKNMGWSDVTGWVGQGGAFLGTK
RTLPEGKFKEVAARLKEHGIQALLIIGGFEAYHAAGQLADQRDNYKEFCIPIVVIPSTIS
NNVPGTEFSLGADTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLSGLAGGA
DAAYIYEEKFSIKDLQQDVYHMASKMSDGVQRGLILRNEKASDNYNTEFIYRLYSEEGKG
LFSTRMNVLGHMQQGGSPTPFDRNMGTKMAAKCVEWLVEQLKANTQPDGSICAKSPDTAC
LLGLVRRQYKFSPLKDLIAETNFEQRIPKQQWWLKLRPLLRILAKHDSTYEEEGLYITVD
EEMSTDSPVA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggcaccactagctccagttcaacggtttatccaacatggtgcgcataaaggcaaaggt
attgccgtcttcaccagtggtggagattcgcagggcatgaatgcggccgtccgtgccgtt
gtccgaatgggcatttacgtcggatgtaaggtctacttcatccgcgagggttaccagggc
atggtcgatggcggtgacaacatcgtggaagccaactgggcctcggtatccagtattatc
catcgcggtggtaccgtcatcggttctgcccgctgcatggacttcaaggaacgagccggt
cgtttgaaggccgccctcaacctggtcacccgtggaatcaccaacctggtggtgatcggt
ggtgacggttcgctgactggcgccaacctgttccgacaggaatggtccagtttactggac
gaactgctgtcaacgggtaagatcactcaggaccagcgcaccaagaacaagagcttgcac
attgccggcatggtcggttcgatcgataacgacttctgcggtacggatatgaccatcggt
acggattcggctctgcacaggatcatcgaagctattgatgccatcgttagtactgcctac
tctcaccagagaaccttcattatggaggtcatgggcagacactgtggttatctcgcagta
gtcgccggcctgtgcattgaggctgattacattttcattcccgaagatccaccaaaaccc
gattggcccgaaagaatgtgccgccaattgaaccaggagcgctccgccggtcaaagattg
aacattatcatcgtatcggagggtgccatcgatcgcgagggtcagcccatcacggccgaa
aaggtcaaacaggtggtggtcgacaagctgcaccaggacaccaggattacggtgctgggt
catgtgcagcgcggaggtaacccgagtgcgttcgatcgcgtactgggttgccgcatgggt
gctgaagcagtgctggcgctgatggaagcggacgacaaaaccgaaccgtgcgtcgtatcg
ttggacggaaaccaagccgtgcgagtcccactcatggaatgtgtccagcgcaccaaagcc
gtcgcccaagccatggctgacaaaaactgggaaatggccgttgaacttcgtggtcgctcc
ttcgccagaaacttggagacctacaagatgttgacccgcctgaagccaccgaaggaggct
ttcgattcccaaggtcgtggagtcggtggatacaccatggccgtgatgcacattggtgcc
ccagcttgcggtatgaacgctgctgttcgatcattcgtgaggaactgtatctaccgaggt
gactccgtgatgggtattcacgacggtatcgaaggtttggttgccggaaacatcaagaac
atgggatggtccgacgtgactggctgggtcggacagggtggtgctttcctaggtaccaag
cgtacccttccagagggaaaattcaaggaagttgcagcccgtctgaaggaacatggcatc
caggcccttctcatcatcggcggatttgaagcctaccatgctgctggacagttggcagat
caacgcgataactacaaggagttctgcatccctatcgtggttattccatcgaccatttcc
aacaacgttcctggaacagagttctctctaggtgccgataccggtctgaatgaaatcacc
gagatttgtgaccgcatccgtcaatcggctcagggtactaaacgccgtgtcttcgttatt
gaaactatgggcggctactgcggttacttggctaccttatcgggtttggctggtggtgcc
gatgctgcctacatctacgaggagaagttctccatcaaggacttgcagcaggatgtgtac
cacatggcatcgaagatgagcgacggcgttcaacgtggtttgattctgcgtaatgagaag
gcttccgacaactacaacaccgagttcatctaccgtttgtactcggaggaaggcaaggga
ttgttctccacccgaatgaatgtgctgggtcacatgcaacagggtggctcaccgacgccc
ttcgatcgtaacatgggtaccaagatggcggccaagtgcgttgagtggctggtggagcag
ctgaaggccaacacccaacccgacggtagcatctgcgccaagagtcccgatacggcctgc
ctgttgggattggttcgccgtcagtacaaattctcgcccctcaaggacctgatcgcggag
accaacttcgaacaacgcatccccaagcagcaatggtggctgaagctgcgcccactgttg
agaatcctggccaagcacgactccacctacgaggaggaaggcctctacataactgtcgac
gaagagatgtccaccgattcaccggtcgcctaa

DBGET integrated database retrieval system