KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL006978Help
Entry
AaeL_AAEL006978   CDS       T01053                                 

Definition
protein-glutamine gamma-glutamyltransferase
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     AaeL_AAEL006978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 804 aa AA seqDB search
MGNKCSTSSCGGCFGGCSGEHKASDSCCSCCGMRFRRVWKPARVDTGERGRLMAGHNPLA
KPMMEMKDMDVVDAPSADVLTIKKVDMCIDENGKLHHTKRYELMTRDGQVGPPARLVVRR
GQAFRLRLHCDRPFDRSRDAMSLIFTVDGEERPTHGHGSLVGVALQQYRHLIEDPLEWGA
AIDFISGDMLEILVKPAATAAVTRWKLDFDTKLLSEGFGKSYSLPQSFYLLFNPWCKDDQ
VYLEEKPLRDECVMNDTTLIWRGSYNRLRPSVWKFGQFERHVLDCSLLLIDKVGKVSATH
RGDPIRVCRAISAAVNSPDDDGALLGNWSGDFSGGTAPTKWVGSVEIMQQYYKKQKPVKF
GQCWVFAGVVSTIARAIGIPSRVVTNYSSAHDTQASLTVDYFVDQNGKVMEELNSDSIWN
YHVWNEVWMQRPDLGISSDGDYGGWQAIDSTPQEMSDGMFRCGPASVLAVKLGEIAKPYD
NNFLFAEVNADKVFWRYTGPAHPLKLLRKDVLGIGHFISTKAVGKWEREDITSSYKFAEK
SQEERDTMMKALKQANSAFSRYYLNEDFNEVYFNFELRDDIKIGENFSVILQIKNRSSEM
VHVVKGSLNVETVLYTGKEREMVKSDHFTITVKPNTEEFVKLVVTFEEYFKKLRDQAAFN
ISCFATVEETEYEFFAQDDFRVRKPDIKIKLSDAPVSQSPVDVTISLLNPLPIPLRKGIF
HVEGSGIESPLIFKHSDVAVGETITNTFSLTPEFAGRATIAAKFTSKELDDVDGFLAFEA
KPRPEDVLMETSDNEIIARTDVID
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggggaacaagtgcagtacaagcagttgcggtggatgtttcgggggttgttctggagaa
cataaggccagtgatagctgttgcagttgctgcgggatgcgattcagaagagtatggaaa
cctgcacgggtcgacacgggtgaacgggggcgtctcatggcaggacataatccactggct
aagccaatgatggagatgaaggacatggatgttgtagacgccccctcagccgatgtgctg
acgatcaaaaaggtagacatgtgtatcgatgagaacggaaagctgcatcatacgaagcgg
tacgagctgatgacccgtgatggccaagttggacctcctgctcggttggtggtccgaagg
ggtcaagccttccgtctgcgattacattgtgatcgacctttcgatcgtagtcgcgatgcg
atgagtttgatattcaccgttgacggggaagaacggccaacacacggccatggatcgctg
gttggggttgcccttcaacagtatcgtcacttgatcgaggatccactggaatggggagcc
gctatcgacttcatcagtggggacatgttggagatcttggtgaagccagcggcaactgct
gctgtaaccaggtggaagctggactttgatacgaaactgttgagcgaaggatttgggaag
agttattcactgccgcaatcgttttatttgctgttcaatccttggtgcaaggatgatcag
gtgtatttggaagagaaaccgcttcgcgacgaatgcgttatgaacgatacaacgttgatc
tggagaggatcctacaatcggttgcgaccttcggtgtggaaattcggccagtttgagagg
cacgttctggactgctcactgctgttgatcgacaaggtcggtaaggtaagtgccactcat
cggggtgatccgattcgcgtttgtcgtgccatttcggcagcggtcaactcgccagatgat
gatggagcattactcggcaactggagtggcgatttctcgggtggaaccgcacccaccaag
tgggtcgggtcggtagaaattatgcagcaatactataaaaagcagaaacctgttaaattt
ggccagtgttgggtatttgccggagttgtttccacaattgctagagcgattggaatcccg
tctcgcgtggtcacaaactactcatcggcccacgatacgcaggcttcgctaacggtagac
tatttcgtagaccagaacggaaaggtcatggaggagttgaattcggattccatctggaac
tatcacgtttggaatgaggtgtggatgcagcgtcccgatttgggaattagttcggacggg
gattacgggggttggcaagcgatcgattctacgcctcaggagatgtcagatggtatgttc
cgctgtggacccgcctcggtactggcagtcaaactgggagagatcgcaaaaccatacgac
aataactttttgtttgctgaggtgaatgcagataaagttttctggagatacaccggacca
gcccatccgctgaagttgcttcggaaggatgttctggggattggtcactttataagtact
aaggctgttggaaaatgggagcgagaggatatcactagtagctataagtttgccgagaaa
tcacaggaggagcgagataccatgatgaaagctctgaagcaggcaaatagtgcattcagt
agatactacttgaatgaggacttcaacgaggtttactttaattttgaattgagggacgac
atcaaaataggagagaatttctcagtgattctacaaattaaaaatcgatcgtcagaaatg
gttcacgtcgtcaaaggttcgctgaatgtggaaactgtcctctacacgggaaaagaacga
gaaatggtgaaatccgaccattttaccataaccgtgaagccaaacacggaagagttcgtc
aagttggtggtcacatttgaggaatacttcaaaaagttgcgggatcaggcggcgttcaac
atttcatgtttcgccactgtcgaggagacggaatacgagtttttcgctcaagatgacttc
cgcgttcgtaagcctgacatcaagatcaaactgtccgacgctccggtatcgcagagcccc
gtggatgttaccatatctctattgaatcctcttcccattcctctcaggaaaggtattttc
cacgtagaaggatcgggaatcgagagtccgttaattttcaagcattcggacgtcgccgtt
ggagagacgatcacaaatactttcagcttgactccggagtttgccggtcgtgctacgatt
gctgccaagttcacttccaaggagctggacgatgttgatggttttcttgccttcgaagct
aaacctcgaccggaagatgtgctgatggaaaccagcgacaatgaaatcattgcccggaca
gatgttatcgattga

DBGET integrated database retrieval system