KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007066Help
Entry
AaeL_AAEL007066   CDS       T01053                                 

Definition
mitotic checkpoint protein and poly(a)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL007066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 359 aa AA seqDB search
MFGATLGGTSAFGATTAAPTNPMKDFEVTSPPDDTVSAMEFSPATLQQNFLIAGSWDCSV
RCWEVEQTGKTVGKSIKTMGGPVLDVCWADDGSKVFIASADKQVKCWDLASDQVVQVAQH
DAPVKTCHWVKGTNYTCLMTGSWDKTLKFWDTRTPQPMMSIQLPERCYCADVDYPMAVVG
TAGRHVLIYSLENKPTQYKQQESPLKYQHRTVSIFRDKKKAPTGYALGSIEGRVAIQYVN
PINPKDNFTFKCHRSNGSNGYQDIYAVNDIAFHPVHGTLATVGSDGTFSFWDKDARTKLK
SSETMDQSITKCCFNATGQIFAYTVGYDWSKGHEYNNPQKKTYIFLRSCYEELKPRANN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcgcaacgcttgggggcacttccgcctttggagcaaccacagcggccccaacc
aatccgatgaaggatttcgaggtcacatcgccaccggatgacacggtttcggccatggag
ttcagcccggcaacgttgcagcaaaactttctgattgccggcagttgggactgcagtgtg
cgctgttgggaagttgagcagacggggaaaaccgtgggcaaatccatcaaaaccatgggc
ggaccggtgctggatgtctgctgggccgacgatggcagcaaggttttcatcgcatcggct
gataaacaggttaaatgttgggacttggcttcggatcaggttgtgcaagttgctcagcac
gacgctcctgttaagacatgtcactgggttaaaggaaccaactacacctgcttgatgacc
ggctcgtgggacaaaaccttgaagttctgggacactcgaacgcctcagccaatgatgtcc
attcagcttccggaacgatgttactgcgctgatgtcgactatccaatggcagttgtggga
acggccggacggcatgtcctgatctattccttggagaacaaaccaactcagtacaaacag
caggaaagccctctcaagtaccagcaccgaacggtttccattttccgtgacaagaagaaa
gctccgaccggatatgctctgggttccattgagggccgagttgctattcagtatgtgaac
cccatcaatccgaaggacaactttacattcaagtgccatcgttcgaatggttccaacgga
taccaggatatctacgcagtcaatgacatagcattccacccggttcatggaacactggcc
actgttggttctgatggtacgttcagcttctgggacaaagacgccaggacgaagcttaaa
tcatcggaaacgatggaccaatccatcaccaaatgttgcttcaatgctacgggccagatt
tttgcatacaccgttggatacgattggtcaaaaggacacgagtacaacaatccccagaag
aaaacgtacattttcctgcgttcctgctacgaagaactcaaaccacgggcaaataactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system