KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007153Help
Entry
AaeL_AAEL007153   CDS       T01053                                 

Definition
5'-AMP-activated protein kinase, catalytic alpha-1 chain
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    AaeL_AAEL007153
   04150 mTOR signaling pathway
    AaeL_AAEL007153
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    AaeL_AAEL007153
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AaeL_AAEL007153
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   AaeL_AAEL007153
Mitochondrial biogenesis [BR:aag03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    AaeL_AAEL007153
  Mitophagy factors
   Other mitophagy factors
    AaeL_AAEL007153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 545 aa AA seqDB search
MTDKGTTTAQPLVKIGHYILGATLGTGTFGKVKIGEHQVTKHKVAVKILNRQKIKSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVNNGKLQESEARR
FFQQIISGVDYCHRHMIVHRDLKPENLLLDHNRHVKIADFGLSNMMLDGEFLRTSCGSPN
YAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLN
KQVVSLLCQMLQVDPLKRATVEEIKKHEWFQKDLPAYLFPSPVEQDSSVIDTHAVAEVCE
KFGVKEQEVHNALLSGDPHDQLAIAYHLIIDNKRIADEAAKAELKDFYVAVSPPPAPPVQ
PERHTPVNEPFKSPSIHPERIAPLRERPATTGSAPIPSPNITATAIPIDKHRGTPVKRAK
WHLGIRSQSKPNDIMLEVYRAMKALDFEWKIINPYHVRVRKYNSRNDKYVKMSLQLYQVD
TKSYLLDFKSLTNDEVEQGDDVIMESLTPPPPIGFGGMGIPNQPTGHHTMEFFEMCAALI
IQLAR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagggaacgaccacggctcagccgctggtaaagataggtcattatatcctg
ggggccaccttgggaacggggaccttcgggaaggtcaaaatcggcgaacaccaggtaacg
aaacacaaggtcgccgtaaaaatcctgaaccgccagaagatcaaaagcttggatgtggtg
ggaaaaattcgtcgcgagattcagaacctgaagctattccgacatccgcacataattaag
ctgtatcaggtgatatccactccgaccgatatatttatgattatggaatatgtcagcggg
ggagagctgttcgactacatcgtgaacaatggcaaactgcaggaatcggaagcgagacgg
ttcttccagcaaatcatttccggggtggactattgccatcgccatatgattgtgcatcgc
gatttgaaaccggagaatctgctactggatcataataggcacgttaagattgccgatttc
ggactttccaacatgatgctggatggagagttcctgcggacttcatgtggatcgcccaac
tatgctgcgccggaagtaatctcgggaaagctatatgctggtcctgaagtggacatctgg
tcctgtggtgttattttgtacgctttgctttgcggaactctcccattcgatgatgagcac
gttccgacgctgttcagaaaaatcaaatctggcatattccccatcccggaatacttgaac
aagcaagtggtgagcttactgtgccagatgttgcaagtcgatccgctcaaaagagcaact
gttgaagaaatcaagaagcacgaatggttccagaaggatctaccggcctatttgtttcct
tccccagtggaacaggacagcagtgtcattgatacacatgcagtggcagaggtctgcgag
aaattcggcgtcaaggaacaggaagtgcacaacgctctgctgagtggcgatccacatgat
caacttgctattgcttaccatttgattattgataataaacgtattgctgacgaagctgcc
aaagcagaattgaaggacttctacgtggcagtgagtcctccgccagcaccaccggtccaa
ccggaacgacatactcctgtgaatgagcccttcaagtcgccttctattcatccggaaaga
attgccccgttaagagagagaccagccactactggcagtgccccgataccatcgccaaac
attactgcgacggccataccgatagataaacaccgcggaacaccggttaaacgagccaaa
tggcatctcggcattcggtcccagtctaaacccaacgatatcatgctggaagtttatcgt
gccatgaaggccctcgatttcgaatggaaaattatcaatccctatcatgtgcgcgtccgc
aagtataattcacgcaatgataagtacgtgaaaatgtcccttcagctgtatcaggtcgac
accaaaagctacctgctggattttaaatctcttaccaacgacgaggtggaacagggagac
gatgtgattatggagagccttaccccgccccctccgattgggttcggcgggatgggcata
ccgaaccaaccgaccggacaccatacgatggaatttttcgaaatgtgcgccgcactcatt
attcaattagctcgttaa

DBGET integrated database retrieval system