KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007293Help
Entry
AaeL_AAEL007293   CDS       T01053                                 

Definition
camp-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aag04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:aag04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 353 aa AA seqDB search
MGNNATSTNKKVDAAESVKEFLDQAKEDFEEKWKRNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKSTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLKFHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSELKDLLRNLLQVDLTKRYGNLKAGVNDIKGHRWF
ASTDWIAVFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggggaacaacgctacatccacaaataaaaaagttgatgctgctgagagcgtaaaggaa
tttttagatcaagcaaaagaagattttgaggagaaatggaaaaggaatcctaccaacact
gctgccctggatgatttcgagcgtattaaaacgctcggaacaggatctttcggaagggtc
atgatagtacaacataagtcaaccaaagattactatgctatgaaaatactggataagcaa
aaggtagtcaagcttaaacaggttgagcatactctcaacgaaaagaggattctacaagca
atttctttcccatttttggttagcttgaagtttcatttcaaggataattcaaatctatac
atggttctggaatatgttcctggtggagaaatgttctcccacttacgtaaggtgggacga
ttttcggaaccgcattctcgtttctacgctgcgcaaatagttctcgctttcgagtactta
cattatctagatttgatatatcgtgatttgaagcccgaaaacctgttgatcgattcgcaa
ggctatctcaaagttacggactttggttttgctaaacgcgtgaaaggaagaacatggacc
ctttgtggcactccagaatatttggctccggaaattattttaagcaaaggttacaacaag
gccgtcgattggtgggcactaggagttttggtatatgaaatggcagctggctatccccca
ttttttgctgatcaacccatacagatctacgagaaaatagtgtccggaaaagttcgattc
ccgtcacactttggctcagagttgaaagatcttctaagaaatttgcttcaggtcgactta
accaagcgttatggtaacttgaaagcaggcgttaacgatattaagggccacagatggttt
gcctccactgattggatcgctgtgttccaaaagaaaattgaagctccgtttataccacgc
tgcaaaggacccggagacacaagcaactttgacgattacgaagaggaagcattaaggatc
tcaagcaccgaaaagtgtgcgaaggagtttgccgaattctaa

DBGET integrated database retrieval system