KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007370Help
Entry
AaeL_AAEL007370   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AaeL_AAEL007370
   00670 One carbon pool by folate
    AaeL_AAEL007370
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AaeL_AAEL007370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 186 aa AA seqDB search
MKKFSLIVAVCANGGIGIKGDLPWRLRQELKYFSRMTKKITDTSKRNAIIMGRKTYFGVP
ESKRPLPERLNIILTRDPSANTYPSDVMVCKSMQEALTKLDESPLANEIEKIWIVGGNAV
YKEAMQSERCHRIYLTEIKETYECDAFFPEITSEFQLVKNDDDVPEEIQEENGIQYQYRI
YEKLPK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttcagcttaatagttgcagtttgtgccaatggtggaattggcatcaaagga
gatctgccttggagattgaggcaggagttgaaatacttttctagaatgacgaagaagatc
actgacacaagcaaacgcaatgccattatcatgggccggaagacttacttcggtgtacct
gagtcgaaacggcctttgccagagagactgaacattattctaactcgagatcccagtgcc
aatacttacccatctgatgtgatggtgtgcaaaagcatgcaagaagcactgacaaagcta
gatgaatctccgttggctaatgaaatcgaaaaaatttggattgtcggcggcaatgcagtc
tacaaagaagcaatgcaatctgagagatgccaccgtatctatctgacggaaatcaaggag
acgtacgaatgtgacgcattcttcccggaaatcactagcgagtttcaactggtgaagaac
gatgatgatgttcctgaggagatccaagaggaaaacggaattcagtaccagtaccgcatt
tatgaaaaacttcctaaatga

DBGET integrated database retrieval system