KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007375Help
Entry
AaeL_AAEL007375   CDS       T01053                                 

Definition
pyruvate dehydrogenase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     AaeL_AAEL007375
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   AaeL_AAEL007375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 411 aa AA seqDB search
MRLFPVRMSNINKMLDFYSQFNPSPLSIKQFIDFGLNACPTKSYIFLRKELPVRLANIMK
EITLLPEGLLRMPSVGLVSAWYVKSFEEVLEFEKTEPTGDNLDKFCKSLIQIRDRHSDVV
QTMAQGILELKESRNGQIEPSTELSMQYFLDRLYMSRISIRMLINQHTILFGEIPQSGRH
VGCIDPLCDPHMVVRDAYENARFLCDQYYLASPELEVIEHNDLEKGKPIKIVYVPSHLYH
MLFELFKNSMRAVMEYHGAEDDIPPIKVTIVKGKEDICVKMSDRGGGIPRSHVDQLFKYM
YSTAPQPPKSKSDLPLVPLAGYGYGLPISRLYARYFHGDLVLYSCEGYGSDAVIYLKALS
DEANELLPIFNKTSSRFYKATVPTGDWSNQNSDMNSKQMNAQTRRNTTVSN
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctatttccggtgcggatgtccaacatcaataagatgttggatttctattcccag
ttcaacccttcacctttaagtatcaaacagttcatagactttggtctcaatgcatgtccc
acgaagtcgtacatatttctacgtaaggagttaccagtcagattggccaacataatgaag
gaaatcacacttttaccagaaggtctgctaaggatgccttcggtgggtttggtcagtgca
tggtacgtgaaaagttttgaggaagtccttgagtttgagaaaacagaacccactggtgac
aatctagacaaattctgcaaatctctcatacaaatccgtgaccggcattcagatgtcgtg
caaaccatggcgcagggaattctagagctgaaagaatcgcgaaatggacaaatcgaacca
tcgaccgagctctcaatgcagtacttcctagaccggctgtacatgtcacgtattagcatt
cgaatgctaatcaaccaacacacgattttattcggagagattccgcaatcaggcagacat
gttggatgtattgatccattgtgtgatccgcacatggtcgttcgagacgcttacgagaat
gcacgctttctatgtgaccaatactatcttgctagtcctgaattagaagtgatagaacac
aacgatctggaaaagggtaaacctatcaaaatagtgtacgtaccttctcacctgtatcat
atgctcttcgagctattcaaaaactcaatgcgtgccgtaatggaataccatggtgccgaa
gatgatattccacccatcaaggtcaccattgtcaagggcaaagaggacatctgcgtcaaa
atgtctgaccgtggcggtggcattcccagatcccatgtcgatcaactgttcaagtacatg
tacagcacagcaccgcaaccgccaaaatcaaagtccgacctcccgcttgtccccttggcc
ggttatggctacggtttacctatttcgaggctgtatgcacgctatttccatggagatttg
gtactatactcatgtgaaggatacgggtctgatgctgtgatatatttgaaggcactttct
gacgaggcaaacgagctgttgccaatcttcaacaagaccagctctcgtttttacaaggcc
accgtgccaaccggagattggtcaaatcagaactcggatatgaactctaagcagatgaac
gcccaaaccagacgcaacacgacagtatccaattga

DBGET integrated database retrieval system