KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007494Help
Entry
AaeL_AAEL007494   CDS       T01053                                 

Definition
calcineurin b subunit
Orthology
K17610  
calcineurin B homologous protein 1
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AaeL_AAEL007494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MGNKSSLLLREEEIAQIHEETGFTPNQIERLYSRFTSLDRSDCGTLTREDFLRIPELAIN
PLCERIVHSFFADSSDDRVNFRQFTQVLAHFRPIKPNKENKLNSREEKLRFAFKMYDLDD
DDNISRDELLSILQMMVGANISQDQLNSIAERTIVEADSMGQGKITFEDFCRALERTDVE
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaagtcatcattgctgctgcgggaggaggaaattgcccagattcacgaggaa
acgggatttacgccgaaccagattgaacggttgtattcgcgattcacatcgctggatcgc
agcgattgcgggactttaacgcgggaggatttcctgcgcattccagaactggccatcaat
ccgttgtgcgaacggatcgttcactcgttcttcgccgacagcagcgacgatcgggtcaac
ttccgccagttcacacaagtgctggcccatttccggccgatcaagcccaacaaggagaac
aagttgaacagccgcgaggagaagctccggttcgcgttcaagatgtacgacttggatgac
gacgataacatctcgcgggacgagctgctcagcattctgcagatgatggttggggccaac
ataagccaggatcagctgaacagcattgccgagcggacgatcgtcgaggcggactcgatg
ggacagggcaagatcacgttcgaggacttttgccgtgccttggagcgcaccgacgtcgag
cagaagatgtccattcggttcctgaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system