KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007560Help
Entry
AaeL_AAEL007560   CDS       T01053                                 

Definition
core 1 UDP-galactose:n-acetylgalactosamine-alpha-r beta 1,3- galactosy
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:aag00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 439 aa AA seqDB search
MFLYNGECDCRRLAILLYLLSQSYPLLFETLADGYIRILHFAKIHAGFCGRSHSHPRTLV
TLIFGTVLGFVFATLITSSTNRAPWLPEYYHSREAPAIVSDPHTGHELKGAEGPEQEVGN
HASHEEVHAHENSSLANQLYREVRVLCWIMTNPSNHKAKALHVKRTWGSRCNKLLFMSSK
TDPLLNSIALPVKEGRNNLWAKTKEAFKYIYQHHLDDADWFIKADDDTYVVMENLRYMLY
PYSPSFPIYFGCKFKPFVKQGYMSGGAGYVLSKAAVKRFVEEAIPNKNCRQDHDGAEDVE
MGKCMELVKVLAGDSRDSLGRGRFFPFVPEHHLIPNHVDKDFWYWKYIYYKTDEGLDCCS
DNAISFHYVSPNQMYVLDYLVYHLRPYGIVGHSQPLPNKLSLTDIVHSDDLSKTTERPQM
DKDSSPTDDKQVSNNLLLD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttcctctacaatggcgagtgcgattgccggagacttgcgatattgttgtatttgttg
tcacaatcctacccactattatttgaaactcttgccgatggatatataagaatcctgcat
tttgcaaaaatccacgcaggattctgtggacgcagtcatagccatccccggacgttggtt
acgcttatatttggcacagtgctcggatttgtgttcgccactttgatcacctccagcacc
aatcgagctccgtggctaccggaatattaccactccagggaagctccggcgatagtaagt
gatccacatacgggccatgagctgaagggtgccgaaggtcccgaacaggaagtcggcaat
cacgcttcccacgaggaagtacacgcccatgagaattcatcgctggcgaatcaactgtat
cgggaggtacgggtactatgctggatcatgacaaatcccagtaatcacaaagcgaaagct
ctgcacgttaagcgcacgtggggctcacggtgcaataagttgctgtttatgagctcaaag
actgacccgcttctaaatagcatcgctctgccagtgaaagaaggtcgcaataatctgtgg
gcgaaaaccaaggaagcattcaagtacatctaccagcatcatctcgacgatgccgattgg
ttcatcaaggctgatgacgacacttacgttgtgatggaaaatcttcgatacatgctgtat
ccatactcacccagctttccaatatactttgggtgtaaattcaaaccgttcgtaaagcag
ggctacatgtccggtggcgccggctacgtgcttagcaaagcggctgtgaaacgatttgtg
gaagaggccattccgaacaaaaactgtcggcaggatcacgatggtgccgaagatgtggaa
atgggtaaatgcatggaattggtaaaagttctggctggtgattcaagagactctctagga
agaggtcgattcttcccgtttgtacctgagcatcatctgataccgaatcacgtagataaa
gatttctggtactggaagtacatctactacaagacagacgaggggctggattgctgctcg
gataatgcaatctcgttccactacgtctcgcccaatcagatgtacgtgctggactatctg
gtctaccatctgcggccatacggtatcgtaggtcactctcaacctttaccgaacaagctc
tccctgacggacatcgtccattcggatgatctaagcaaaactaccgagcgaccccaaatg
gacaaggactccagcccgactgatgacaaacaggtgtccaacaatcttttgctggattag

DBGET integrated database retrieval system