KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007560Help
Entry
AaeL_AAEL007560   CDS       T01053                                 

Definition
core 1 UDP-galactose:n-acetylgalactosamine-alpha-r beta 1,3- galactosy
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    AaeL_AAEL007560
Enzymes [BR:aag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     AaeL_AAEL007560
Glycosyltransferases [BR:aag01003]
 Glycan extension
  Type 3 chain
   AaeL_AAEL007560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 439 aa AA seqDB search
MFLYNGECDCRRLAILLYLLSQSYPLLFETLADGYIRILHFAKIHAGFCGRSHSHPRTLV
TLIFGTVLGFVFATLITSSTNRAPWLPEYYHSREAPAIVSDPHTGHELKGAEGPEQEVGN
HASHEEVHAHENSSLANQLYREVRVLCWIMTNPSNHKAKALHVKRTWGSRCNKLLFMSSK
TDPLLNSIALPVKEGRNNLWAKTKEAFKYIYQHHLDDADWFIKADDDTYVVMENLRYMLY
PYSPSFPIYFGCKFKPFVKQGYMSGGAGYVLSKAAVKRFVEEAIPNKNCRQDHDGAEDVE
MGKCMELVKVLAGDSRDSLGRGRFFPFVPEHHLIPNHVDKDFWYWKYIYYKTDEGLDCCS
DNAISFHYVSPNQMYVLDYLVYHLRPYGIVGHSQPLPNKLSLTDIVHSDDLSKTTERPQM
DKDSSPTDDKQVSNNLLLD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttcctctacaatggcgagtgcgattgccggagacttgcgatattgttgtatttgttg
tcacaatcctacccactattatttgaaactcttgccgatggatatataagaatcctgcat
tttgcaaaaatccacgcaggattctgtggacgcagtcatagccatccccggacgttggtt
acgcttatatttggcacagtgctcggatttgtgttcgccactttgatcacctccagcacc
aatcgagctccgtggctaccggaatattaccactccagggaagctccggcgatagtaagt
gatccacatacgggccatgagctgaagggtgccgaaggtcccgaacaggaagtcggcaat
cacgcttcccacgaggaagtacacgcccatgagaattcatcgctggcgaatcaactgtat
cgggaggtacgggtactatgctggatcatgacaaatcccagtaatcacaaagcgaaagct
ctgcacgttaagcgcacgtggggctcacggtgcaataagttgctgtttatgagctcaaag
actgacccgcttctaaatagcatcgctctgccagtgaaagaaggtcgcaataatctgtgg
gcgaaaaccaaggaagcattcaagtacatctaccagcatcatctcgacgatgccgattgg
ttcatcaaggctgatgacgacacttacgttgtgatggaaaatcttcgatacatgctgtat
ccatactcacccagctttccaatatactttgggtgtaaattcaaaccgttcgtaaagcag
ggctacatgtccggtggcgccggctacgtgcttagcaaagcggctgtgaaacgatttgtg
gaagaggccattccgaacaaaaactgtcggcaggatcacgatggtgccgaagatgtggaa
atgggtaaatgcatggaattggtaaaagttctggctggtgattcaagagactctctagga
agaggtcgattcttcccgtttgtacctgagcatcatctgataccgaatcacgtagataaa
gatttctggtactggaagtacatctactacaagacagacgaggggctggattgctgctcg
gataatgcaatctcgttccactacgtctcgcccaatcagatgtacgtgctggactatctg
gtctaccatctgcggccatacggtatcgtaggtcactctcaacctttaccgaacaagctc
tccctgacggacatcgtccattcggatgatctaagcaaaactaccgagcgaccccaaatg
gacaaggactccagcccgactgatgacaaacaggtgtccaacaatcttttgctggattag

DBGET integrated database retrieval system