KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007690Help
Entry
AaeL_AAEL007690   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AaeL_AAEL007690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1300 aa AA seqDB search
MCNMIETTDKSTDNIVEEEDDSKLPISFTCARHLSKIEGINCTTQSWRVKERMKTVSVAL
VLCLNVGVDPPDVVKIQPCSRLECWIDPSSVSPQKAMELIGNNLQKQYERWQPRARYKQS
SDPTVEDVKKLCTSLRRNSKEERVLFHYNGHGVPRPTVNGEIWVFNRTYTQYIPLSIYDL
QTWMGAPSIYVYDCSNAGIIVNSFNTFAEQHERELEQMRARSGSTAGQSDADASRNSPSP
PVVGPTTYKNCIQLAACAANQILPMNPQLPADLFTACLTTPIRIALKWFTLQSTSKLVPH
VPEDLIERIPGQLNDRRTMLGELNWIFTAITDTIAWNTLPRELFQKLFRQDLLVASLFRN
FLLAERILRSYDCTPISSPPLPQSYRHPMWSAWDLALDLALSQLPDILEKGKRFKHSPFF
EEQLTAFQVWLEGSSEQRNQPEQLPIVLQVLLSQVHRLRALELLGHFLDLGPEEVNLALS
VGIFPYVLKLLQSLAKELRPFLVFIWAKILAVDGTCQIDLIRDLGHKYFLAALQDTSPCP
GFKGNHRVYAAFVLASIVHNFPMGQAHALQGQLVSICLDQLNDENFVLRQWLAICLGHLW
QNYEQARWSGVRDNANEKLYPLLSDPIPEVRAAAVYALGTFISSVQQRSDHANNVDRSTA
MHLFNTVCNDMSPLVRMELIASLQWMVRFFENQFVAVFLQEPSSGHHMLNHHYHSLERNI
NMKRVSSSSNIISGGKNAVSVGSTYQKLWNGLNVLAKDPFPAVAAMAQKVVEYVAKQGLE
AKEAISSEKFAGSLSLPPSPNTRVNYLGGESPPLHGHLNQSNHHTPLPNKKKLNPNDNLE
LSSSTLQLQSVVTSTPIHTPQQQQQQSCESMPPPQAPTPQVQSQPRSSQAQQPQTVTPIV
TTNYIEWSVSFFARPSKFLNEGKLTAKDQNSTEFLDRQSRCLRNRIVREEGREQQRRAVF
GRLDTQSWSCRTQHTPTLVKLNPYDDQIAVAYKDRVILHDCSTDITSSFIPFKQQNQSIF
LDQNRFQVSPPPVSVSSLDFINAHDVGLVLVGYTDSVIRVWRPADANRESALVTAWHGLF
DFNSPATAKVGTSELGLVMAWHQKTQTIMAAGEAKYIRLWDAERESRICDIPSGSDTTII
KLSCAPNGLFAAGCSNGSVRLFDRRCAPTEARIATFREHMNPILTVCLRDDCESLVSACT
TSTVRLYDIRKTASSVQHWSAGSDVSAMSIHSSADIVACATSIITIYGLDGTSLNTIRCN
EGFMGTKKGVTSCLSFHKHKISLAAGFNDNTAAVFVTDRK
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaacatgatagaaacgaccgataagagcaccgacaacatcgtcgaagaggaggat
gattccaagttgccgatcagtttcacctgtgctcgtcatttgagcaaaatcgaggggata
aattgtacgacacaaagctggcgcgtcaaggaacgcatgaagaccgtcagtgtggcgctc
gttctttgtctcaatgtgggtgttgacccgccggatgtggtgaagatacagccctgttcc
aggctggaatgctggatcgatccttcgtcagtgtcgccacagaaggcgatggagttaata
ggcaacaacctccagaaacaatacgaaagatggcaaccacgcgcacgttataagcaatcc
tcagaccccacagttgaggacgtaaaaaaactatgcacgtctctgcgcagaaattcaaaa
gaggaacgcgtgctgttccactacaatggccacggagttccgcgacccaccgttaatggc
gaaatttgggtcttcaaccgaacgtacacccaatacatccctttgtcaatttacgacctg
cagacgtggatgggtgccccctcgatatacgtctacgactgctccaacgccgggataatt
gtaaatagttttaacacctttgcagagcagcatgagcgagagttggagcagatgcgggct
cgaagcggaagtaccgccggtcaatccgacgccgacgcaagcaggaattcaccgtcgcct
ccggttgtgggtccgactacctataagaattgtattcaattagcggcctgtgcggccaat
caaattctaccaatgaatccccaactgcctgcggatcttttcacggcgtgcttaacgacc
ccgatccgaatagctttgaagtggttcaccctgcaatctacgtcaaaattagttccacac
gtaccggaggatttgattgaaagaataccaggacagctcaacgacaggagaacgatgctt
ggtgagctgaattggatatttacggccatcaccgacacgatagcgtggaacacgttacct
agagagctgttccagaaactgttccgccaagatttgctcgtggcaagcttgttcagaaat
tttctgctcgcggaaagaatcctccggtcgtacgactgtacgcccatttctagtcctcct
ttgcctcaaagctaccgccatcccatgtggtcagcgtgggacttggccctggacctggcc
ctgtcccagctgccagatatcctggaaaagggaaagcgcttcaaacattcgccattcttt
gaggagcagttgaccgcctttcaggtctggttggaaggcagttcggagcaaaggaatcaa
ccggaacagctaccgatcgtgctgcaggtgctcctgtcgcaagttcatcgattgcgtgcc
ttggaattgttgggccacttcctggatctgggccccgaggaggtgaatctggcactcagt
gtcggcatctttccgtacgtgttgaagttgctgcaaagtttggcgaaagagctgcgaccg
ttcctggtgtttatctgggcgaaaatcctagccgtggatgggacttgtcaaatcgacttg
atccgagacctgggacacaaatatttcctcgccgcgctgcaggacaccagcccgtgtccg
ggtttcaaaggaaatcaccgcgtgtatgcagcgttcgtactagcaagtatagttcacaat
tttccaatgggtcaagcgcatgccctgcagggccaactggtgtcgatctgtctggatcag
ctgaatgatgagaatttcgtactgcggcagtggctggcaatttgcttgggtcatctatgg
caaaattacgaacaagccagatggtctggtgttcgggataacgcgaacgagaaactgtat
ccgctgttgagcgatccaataccggaagtcagggctgcggcggtttatgctctgggaacg
tttataagttccgttcaacaaagatccgatcatgctaacaacgttgatcgatcaacggca
atgcatctgtttaacaccgtttgcaatgatatgagtccgcttgtgagaatggagttgatc
gcttccttgcagtggatggtgcgattctttgaaaaccaatttgttgctgtgtttctccaa
gaaccgtcaagtggtcatcatatgttaaaccatcattaccacagtttagagaggaacatc
aacatgaaacgagtttccagttcgagcaatatcatcagtggtggtaagaatgcggtcagt
gtaggatcaacctaccaaaagctatggaatgggttgaatgttctggccaaagatcctttc
cctgcggtagctgcaatggctcagaaagttgtggagtacgtcgcaaaacaaggcctggaa
gctaaggaggcaatcagttcagaaaagttcgcaggaagcttaagtttgcctccctcgcca
aacaccagagtcaactatctgggtggggaatctcctccgctacacggccacctgaatcaa
tccaatcaccatacgccgcttcccaacaaaaagaagctaaatcccaatgataacttggaa
ctatcttcctctacacttcaactgcaatcggtggtcacgtctacaccaatccacacaccc
caacagcagcagcagcaatcctgtgaatctatgccgcccccacaagctcccactccccag
gtgcaatcccagcctcgatcttcgcaggcacaacaaccgcaaaccgtgacccccatcgtc
acaaccaactacatcgaatggtcggtgagtttcttcgcacggccatcaaagttcctgaac
gaaggcaaactcaccgccaaggatcagaactcgacggaattcctcgataggcagtctcga
tgtttgaggaatcgcatcgtgcgggaggaaggccgcgagcagcagaggagagccgtgttc
ggccggctggatacccaaagttggtcctgtcgaacgcaacatacgcccacgctggtcaaa
ctcaatccgtacgacgatcagattgcggtggcttacaaggatcgcgttatcctgcacgat
tgcagcacagacataaccagctcgttcattcccttcaagcagcagaaccagtcgattttc
ctagaccagaaccggtttcaggtgagccctccgccggtgtctgtctcgtcgttagatttc
atcaacgctcacgacgtcggtctggtgctggtaggctacactgacagtgtgatccgagtg
tggagaccggcggacgccaatcgggaatcggccctggttacggcgtggcatgggttgttc
gactttaattccccggccacggccaaagtcgggaccagtgagttggggctggtgatggcg
tggcaccagaagacacaaaccatcatggcagcgggagaggccaagtatattcgcctttgg
gatgcggagcgagagtccagaatctgtgatattcctagcgggtcggatacgacgatcata
aagttatcgtgtgctccgaatggtttgtttgcagcaggttgcagcaatggaagtgtccgg
ctgtttgatcggcgatgtgcaccgacggaggcacgaatcgccacattccgagagcacatg
aacccaattctgaccgtttgtctgagggacgactgtgaaagtctggtatcggcatgtact
acttccactgtgcgattgtacgacatccggaagacggcctcttcggtacagcactggagc
gcaggatcggatgtttccgccatgagtatccactcgagtgcggatattgtggcctgcgct
acgagtatcatcaccatctacggattggatggtaccagtttgaatacgatccggtgcaat
gagggattcatggggacgaagaagggagtgacgtcgtgtctttcgttccacaagcataag
ataagcttagcggcaggatttaacgataacacagcggctgtgtttgttaccgacaggaag
tga

DBGET integrated database retrieval system