KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007718Help
Entry
AaeL_AAEL007718   CDS       T01053                                 

Definition
translation initiation factor 3, subunit S9, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:aag03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 688 aa AA seqDB search
MAKKKGENYDSDGGDDQDYDEEPNFDDPEGFVDDVSDEELLGDFLKQKPCESDGVENVIV
VDNIPVVGPARFHKLQGVLEKLFKTAGTIVNIHYPKDDEENTRGYAFIEFKNPEMAEEAV
KAFNNYRLDKSHTLLVNLFSDFQKYSDIPKEWSPPEPQPYKMQNDLYNFITEPDAQDQFC
VIAESSPGAVQVQFWQNTQPEPVELLTRDRFTETYVKWSPLGTYIVTFHKQGVVIWGGSN
FTKINKFPHSGTQYVDFSPCEQYLVTYGPNGQKIIIWDIRTGTEKRSFISDGTSNMSMFR
WSHDDKYVARMGDNAIHVYETSTFYLLDKKSIKVQGIRNFSWSPTDNIIAYWMSEDLEAP
ARVTLLEIPRKNEIRNKNLFNVADCKIHWQKSGDYLCVKVDRYSKSKKDKKDADVKFLGM
FYNFEIFHMREKDIPVDSVEVKETILAFAWEPVGSKFAIIHGDPASANVSFYEAKKGQEP
TMLKKLEKKICSHLFWSPRGQFIVLANLQAGSFEFVDTNDFTIMKSGDHFRASEVEWDPT
GRYVVTGTSGKVKEDHGYHIWSFQGKILKRVNLKNFILFLWRPRPPTLLSDEKQKEIRKN
LKKYYAQFESKDRIRMTRASKELLEKRAKLREQFVEYRTKRVSEWEEQKYRRMQLRNNID
TDTLDADPDNVEEEIVEILVREDTTLLE
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagaaaggcgaaaactacgacagtgatgggggtgacgatcaggactacgac
gaggagcccaatttcgatgatccggagggttttgtggacgacgtctctgacgaagaattg
cttggtgattttctgaagcaaaaaccttgcgaatcggacggcgtagaaaatgttattgtc
gtggataatattccggttgttggaccggcccgattccataagctgcaaggagtattggag
aaactgttcaagacggccggaacgattgtcaacattcactaccccaaggatgatgaggag
aacacccgaggttacgccttcattgagtttaagaatccggagatggccgaagaagccgtg
aaggcattcaacaactatcgtctggacaagtcgcatacgttactggtaaatttgttttcc
gatttccaaaaatactcggacattcccaaagaatggagccctccggaaccgcagccctac
aagatgcaaaacgatctttataacttcataactgaaccggacgcacaggatcagttctgt
gtgatagccgaatcttcgccgggagcggtgcaggtccagttttggcaaaacacccaaccc
gaacccgtggaactgctgactcgtgatcgtttcacggaaacatacgtcaagtggtctccc
ctgggaacgtacatcgtgacgttccacaagcaaggtgtcgttatttggggtggttccaat
ttcaccaaaatcaacaaattcccgcactctggaactcaatatgtggacttttctccctgt
gaacagtatttggtgacctacggtccaaacggccagaagatcatcatctgggacattcgg
accggaacggaaaaacgttccttcatctcggacggcacttccaacatgtcgatgttccgt
tggtcccacgacgataaatacgtggcccggatgggtgacaatgcaattcatgtgtatgaa
acgtcgactttctatcttttggataagaaatctattaaggtccaaggcattcgcaacttc
agttggtctccaacggataacattattgcctactggatgtccgaagatctggaggctccc
gctcgtgtgactctgttggaaatacctaggaaaaacgaaatccgtaataagaatttattc
aacgtagctgattgtaagattcattggcaaaaatcaggagattacctctgtgtgaaggtc
gatcgttactctaagtctaagaaagataagaaggacgccgatgttaagttccttggtatg
ttctacaactttgaaatcttccacatgcgagagaaggacattcccgtggactcggtagag
gtaaaggagactatcctggcgtttgcttgggaaccagttggatctaagtttgccattatc
catggcgatccagcgtccgcaaatgtcagcttctatgaggccaaaaagggacaagaacct
acaatgttgaagaaattggagaaaaagatttgcagtcatctgttctggtccccgcggggg
cagtttattgtgttggcaaacctccaggctggatcgtttgagtttgtggataccaacgac
tttaccatcatgaagagcggcgatcacttccgtgcttcggaggtggaatgggaccctacc
ggccgatatgtggtgactggaacctctggaaaggtcaaggaggatcacggttatcacatt
tggtccttccaaggcaagatactgaagcgcgtcaatctgaagaacttcattcttttcctc
tggcgtcctcgtccgcccactctattgtcagacgaaaagcagaaagaaatacgcaaaaac
ctcaaaaagtactacgcacaattcgagagcaaggatcgcatccgcatgacccgtgcctcg
aaggaattgttggaaaaacgtgccaaactgcgagagcagtttgtggaatatcgcaccaag
cgtgtgagcgaatgggaggagcagaagtaccggcgtatgcagctgagaaacaacatagat
accgacacattggacgctgatccagataacgttgaagaagaaatagtagaaattctagta
cgtgaagacaccaccctgctcgagtaa

DBGET integrated database retrieval system