KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007839Help
Entry
AaeL_AAEL007839   CDS       T01053                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AaeL_AAEL007839
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AaeL_AAEL007839
   00603 Glycosphingolipid biosynthesis - globo series
    AaeL_AAEL007839
   00604 Glycosphingolipid biosynthesis - ganglio series
    AaeL_AAEL007839
   00511 Other glycan degradation
    AaeL_AAEL007839
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AaeL_AAEL007839
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AaeL_AAEL007839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 578 aa AA seqDB search
MRTVTSEVRTIIFVVIVVAGCFEQHKDSLNASESYLDSLNECRLVCGEYRALWPIPAVVV
NLGYDTREFVPSDIEFDFHASPDDVNVQDYLNQSTRLFLKNLYKECGRNCNLTTNTRIYF
TIKVETTETSLTWSTDESYDLFVDDHDGLLEVSIVAGTVFGARHALETVSQLTALRSYPD
GNCLLILTAVNLKDYPHYSHRGFLLDTARNFISTRAIKRQLDGMASTKLNVLHWHITDSQ
SFPLEIPSLPQMTEYGAYSERQIYSQQDVKDIFRYAKYRGIRIILEFDAPAHAGNGWQWA
PAAGLGNLAVCVNRQPWRKLCIEPPCGQLNPANPNLYPTLQKLYHDFSSLIPPREILHMG
GDEVFFGCWNATQEIVEYLAGQNKGRGPDDFLDLWGEFQQNVLELWDRQRQGLEELQPTV
LWSSHLTDPAVIEKYLPKERYIVQTWVESDKDLPLQLVRKGYRLIVSTKNAWYFDHGFWG
ITNYYNWRKVYNNRLLKSVNVLGGEACIWTEFIDENSLDSRTWPRLAAVGERLWANPEQD
ASKAEGRFYRHRERLITRGLKPEAVTPKWCEQNEGECQ
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgcggacggtcacttccgaagtgcgaacaatcatttttgtggtgattgtcgtcgccggt
tgtttcgaacagcacaaggactccctgaacgcaagtgaatcatatctggacagtttgaac
gagtgccgtttggtgtgtggcgaatatcgagcactttggccgattccggccgttgtagtg
aacttgggttatgatacgcgcgaatttgttcccagtgatatcgagttcgatttccacgcg
agtcccgatgatgtcaatgtgcaggactacctcaatcaatcgacacgcctattcctgaaa
aatctctacaaggaatgtggtcgaaactgtaaccttacaaccaacaccaggatatatttc
accataaaggtggaaacgaccgaaaccagtctgacttggtcaacagacgagtcgtacgat
cttttcgtagacgatcatgacggactgctggaagtatcgatcgtggccggaacagttttt
ggcgctcgtcatgctctagaaacggtctctcagcttacagctctgcgatcctaccccgat
ggcaactgtttactcattctaacggctgtcaatctaaaagactatccgcactattcccat
cgaggcttccttctagacacagctaggaacttcatctcaacccgagccatcaaacgtcag
ttggacgggatggcctctaccaagttgaacgtcctgcattggcacatcaccgattcgcag
agtttcccactggagattcccagcttaccgcagatgactgaatatggagcttactcggaa
cggcagatttattcccagcaagatgtgaaggatattttccggtacgcaaagtatcggggg
attcggatcatactggagttcgacgctccagcgcatgctggaaacggctggcagtgggct
ccggcagccggcctcgggaacctcgccgtctgcgtcaatcgccaaccatggcgaaagctc
tgcatagagcccccctgcggacaactgaacccggccaatcccaatctctacccgacgctg
cagaaattgtatcacgatttctcctcgttgatccctccacgagaaattctccacatgggc
ggtgacgaagtcttcttcggctgctggaatgccacccaggagatagtcgagtacctagcc
ggacagaacaaaggccgagggccggacgacttcctggatctgtggggtgaatttcagcag
aatgttctggagctgtgggatcggcaacgtcaagggctggaagaactgcagcccaccgtg
ttgtggtccagccatttgaccgatccggcggtgattgagaagtatctgcccaaggaacgg
tacatcgtacaaacgtgggtcgagtcggacaaggatcttccgctgcagttggtgagaaag
ggatatcggctgatcgtttctaccaagaatgcgtggtactttgatcatggtttttggggg
atcaccaattactacaattggcgaaaggtgtacaacaacagattgttgaagagcgttaat
gtgctgggcggagaggcctgcatctggaccgagtttatcgacgagaactcgctagattct
cgcacatggccccgattggccgcggtgggagagcgtctctgggcgaatccggagcaagat
gcctccaaagcggaaggacgattctatcggcaccgggagcggctgataacgcgggggctg
aaaccggaagccgtaacgcccaagtggtgcgagcagaacgagggggaatgccaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system