KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007949Help
Entry
AaeL_AAEL007949   CDS       T01053                                 

Definition
clk2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 247 aa AA seqDB search
MDHVRHMAYQLCYAVKFLHENKLTHTDLKPENILFVDSEFTTTFNGRKNREVRRVKCTDI
RLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIMFELYLGITLFQT
HDNREHLAMMERILGTIPYRMARKTRTKYFHHGKLDWDEKSSAGRYVRDHCKPLHRYVLA
ETPDHLQLFDIIRRMLEYDPANRITLGEALRHPFFAKLPPAQRLHEKCNENSVSASSSRE
RSHSLSR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgtgcggcacatggcctaccagctgtgctacgcggtcaaattcctgcacgaa
aacaaactcacccacacggatctgaagccggagaatatcctctttgtggactcggagttc
acgacgacgttcaacggccgaaagaaccgtgaggtccgtcgcgtcaagtgcaccgacatt
cggttgatcgactttggcagtgccacgttcgatcacgagcaccacagtacgatcgtgtca
acgcgccactaccgggcgccggaagtaatcctggagctgggctggtcgcaaccgtgcgac
gtctggtcgatagggtgtataatgtttgaactgtatctgggcattacgctatttcaaacc
cacgacaacagggaacatctggctatgatggagcgtatattgggtacaattccttaccga
atggccagaaaaacccgcaccaaatacttccaccacggaaagctcgactgggacgagaag
tcgtcggcggggcggtacgtgcgcgaccactgcaaacccctgcaccggtacgtgctggcg
gagacgcccgaccacctgcagctgttcgacatcatccgacgcatgctggagtacgatccg
gcaaacagaatcacactaggtgaagccctgcggcatccgttcttcgcaaagctcccgccg
gcgcagcgtttgcacgagaaatgtaatgaaaattccgtctcggccagtagtagccgggag
cgttcccatagtttatcgagatga

DBGET integrated database retrieval system