KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL007958Help
Entry
AaeL_AAEL007958   CDS       T01053                                 

Definition
erk1/2
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AaeL_AAEL007958
   04350 TGF-beta signaling pathway
    AaeL_AAEL007958
   04068 FoxO signaling pathway
    AaeL_AAEL007958
   04150 mTOR signaling pathway
    AaeL_AAEL007958
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    AaeL_AAEL007958
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AaeL_AAEL007958
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AaeL_AAEL007958
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AaeL_AAEL007958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 245 aa AA seqDB search
MKDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQEDLECIINEKARSYLQSLPYKPKVPWSR
LFPNADSNALDLLGKMLTFNPHNRISVEEALAHPYLEQYYDPADEVIVLNFALAWERNGG
YVDDM
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtatatattgttcagtgtttaatggagactgatctatacaaactgctgaaa
acacagagacttagtaacgatcatatctgctatttcctgtaccaaattctgcgcggtctc
aaatacatccactcggcgaacgtgcttcaccgggatctgaaaccgagcaacctgctgctg
aatacgacttgtgatttaaagatttgtgatttcggtctcgcacgagtggctgacccggaa
catgaccacaccggcttcctgacggagtacgttgccaccagatggtaccgagcgccggaa
atcatgctcaattccaagggttacaccaaatcgatcgacatctggtcggtgggctgcata
ctggcggagatgctcagcaaccggcccatcttccccggcaagcactacctggaccagctg
aaccacatcctgggcgtgctgggttcgccctcccaggaggacctcgagtgcatcatcaac
gagaaggcccgcagctacctgcagtcgttgccgtacaaaccgaaggtcccgtggtcccgg
ttgttccccaatgccgactcgaatgcgctggacctgctcggcaagatgctcaccttcaac
ccgcataaccgaatttcggtcgaggaagccctggcgcacccgtacctcgagcagtactac
gatcccgccgatgaggtaattgttctgaattttgcgcttgcctgggagagaaatggggga
tatgtcgatgatatgtga

DBGET integrated database retrieval system