KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008027Help
Entry
AaeL_AAEL008027   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aag00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 937 aa AA seqDB search
MVVASTSHGSSSTSSSTISSQSRSSQPKLHQVGAVGTGMTPKELSDNDDLATGLVLDPIL
GFQTHKMNLKYRPLRVNTDPIKDILEEFIRSQNYARCYQQLMKGNWIPRAVLNKSKLAQK
RLEAHIYRYLRVFDRNAGFVIEACYRYSLEGQKGAKICSTRKWLKNEKIECLVGCIAELT
EKEEDALLQPGKNDFSVMYSCRKNCAQLWLGPAAYINHDCRANCKFVATGRDTACVKVLR
DIEIGEEITCFYGEDFFGDNNRYCECETCERRGTGAFAKDKNGEEQSPNGVRYRLRETDN
RLNRLKSKNNALDLCKTSIGKSEPPSALAALSMKELREKGMTKYDAEMLLAQQKPSFEAV
RPDQSTQETDLSSSTTPAEPSDEKKAKAKHTPDVTSEKMATRSSRRFQTPTEEKKSQPAA
AATTASHPEATTTEEASTPVPLKATRSTRPLRENGRRRYSSNSSLNTDISSVLSSTSSFV
TAKTSVPTAAERKMMPRSMKLPSVSHEDVIVIDDDHNSNHSFASKSSCSTISALSSKEHL
QPPKNNHNTCSSSNDNNVYVFNDLLESNNLNGYTLRNHHTHQQEQKQHHHPPQEEQRQDP
CSTEAPPPEVVERPPSVKRRSITAARRSITEHISPRVTRRKQRLLGMQLVSVTEATATAK
TSSLPDETEKPQTPTKTTTTTTTERAETATDLTSTSGGDGGGSSGASGGLSDSSNRGNRR
KQKLQTRIMQADELVALQRQAAELERIARASLGRVPRRLVLDDGTNEAEDEDDVILSKVT
NCDDTNDKLLRSRNRHEDVIVLSSGSSSSSSSSESNSGKSSGRNNGSASVSNGNSDRVGT
EPLASKTVIGSRKRKVSKSVSESESSSSWENKVPLEQRLVESCLSNIPNQEALLKTPERR
LKLTLRMKRSPVIDEIIESGIAKHRNFLRVLLNSSNC
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggtagtggcctcgaccagccatggaagcagcagtacttcgagttcgaccatttcgagt
caatcgcggagttcgcagccgaagcttcatcaggtgggtgccgttggcaccgggatgacc
ccgaaagagctgtcggacaatgacgatctcgcgaccggcctggtgctggatccgatcctg
ggctttcagacgcacaagatgaacctcaagtaccggccgctgcgggtcaacaccgacccc
atcaaggacatcctggaggagttcatccggtcgcagaactacgcccgctgctaccagcag
ctgatgaaagggaactggatcccgcgagcggtgctcaacaagagcaagctggcccagaag
cgactggaagcgcacatataccgctaccttcgggtgttcgatcgcaacgcgggattcgtg
atagaggcgtgctaccggtactcgctggaaggtcagaagggcgccaagatctgttccacg
cgcaagtggctgaagaacgagaagatcgaatgcttggtgggatgcatcgccgagctgacg
gagaaggaggaagacgcgttgctgcagccgggcaagaacgacttctcggtgatgtacagc
tgtaggaagaactgtgcccagctttggttgggaccggccgcctacatcaaccacgactgc
cgagcgaactgcaagtttgtggcgacggggagagatacggcatgcgtcaaggtgttaagg
gacatcgaaatcggggaggagatcacgtgtttctacggggaggacttctttggggataac
aatcggtactgcgagtgtgaaacatgcgaaagacgagggacgggcgcgtttgcgaaggac
aagaacggcgaggagcagagtcctaatggagtgcgataccggttgagagaaacagacaat
cgattgaaccggttaaagagcaagaacaacgctctggacctgtgtaaaaccagcatcggt
aagagcgaacctccgtctgcgttggctgcccttagcatgaaggagctacgcgaaaaggga
atgaccaagtacgacgcagagatgctactggcgcagcagaagccttcgttcgaagccgtt
cgaccggaccaatcgacacaggaaacggatctgagcagtagcacaactccagctgaacct
tccgatgagaagaaagcgaaagcaaagcatacgccggatgttacatcggagaaaatggca
acacgctcttcccgtcgatttcaaaccccaaccgaagagaagaagtcccaacctgctgca
gcagctacaacggccagccatccggaggcgaccacaacggaggaagcatccactcccgtc
ccgttgaaagccacccgaagcacgcgacccctacgagagaacggccgccgaaggtacagc
agcaacagcagcctcaatacggacatctccagtgtcctgtcgtcgacgtcttcgttcgta
acggccaagacttcggtcccgacggctgccgaacggaagatgatgcctcgctcgatgaag
ctcccttccgtatcgcacgaagacgtcatcgtaatcgacgacgaccacaacagcaatcac
tctttcgcatccaagagcagctgcagtaccatctcggccctctcgtccaaggaacacctt
caaccgccaaagaacaaccacaacacctgcagcagtagcaacgacaacaacgtctatgtg
ttcaatgatctccttgaaagtaataatctaaacggttacacgctaagaaatcaccacacc
caccagcaggagcagaagcagcatcatcatccgccacaggaggaacaacgacaggatcca
tgttccaccgaagcaccaccaccggaagttgtggaacgaccgccgtcggttaagagacgt
tccatcaccgcagcaaggcgttccatcacggagcacatcagtccccgcgtgacacggcgg
aagcagcgtttgctcggcatgcaactggtatccgtgaccgaagctacagcaactgcgaaa
acctcatcactgccagacgaaacggaaaagccacaaaccccaacgaaaacgacgacgacg
acgactaccgagagggcagagactgctacggatctcacatcgacaagcggtggcgacggc
ggtggaagtagcggtgccagcggaggactcagcgatagctccaaccggggcaaccggcgg
aagcagaaactgcagacccggattatgcaagcggacgagctggtggccctgcaaaggcaa
gcggccgaactggagcgaatcgcgcgggcatcgctagggcgtgtcccgcggcgactcgta
ctggacgacggcacaaacgaggccgaagatgaggacgatgtgatcctgtcgaaagtaacc
aattgtgatgatactaatgataagttgttaagaagtagaaaccggcatgaagatgttatc
gttctaagcagcggcagcagcagtagcagtagtagtagtgaaagtaatagtggtaaatct
agtggtaggaacaatggtagcgctagtgttagtaatggaaacagtgatcgtgtggggacc
gagccgctagcttcgaagacggtgatcgggtcgcgaaagcgaaaagtatccaaaagtgtc
agcgaatcggagagcagttccagttgggagaataaggtacccttggagcagcgcctggtg
gaatcctgtctgagcaacataccgaaccaggaagcattgctcaagactccggagagacgt
ttgaagctgacgctccgcatgaaacggagtccggtgatcgacgaaattatcgaatcaggt
atcgccaaacatcgaaactttctacgagttctgctcaactccagcaactgctag

DBGET integrated database retrieval system