KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008062Help
Entry
AaeL_AAEL008062   CDS       T01053                                 

Definition
thrombospondin
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    AaeL_AAEL008062
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    AaeL_AAEL008062
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AaeL_AAEL008062
  Exosomal proteins of colorectal cancer cells
   AaeL_AAEL008062
  Exosomal proteins of bladder cancer cells
   AaeL_AAEL008062
Heparan sulfate/heparin binding proteins [BR:aag00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  AaeL_AAEL008062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1064 aa AA seqDB search
NNMRKILLLFCIAWFSNEGLSLSLDPVASNELETHIKNDFIISLRHIRPRRKFRLSIEAL
FMIDFPTAKNKFSFYLDRKGKRVTVDINSNANTYSKYLEIPGMNETTTIRSLAILFSHNS
LVLFIDCKEGARLDLDIDISKLYLNQDDPNVKLFRERKYPLHLDSSVENALSRTSCQNLL
KRKHTKKTGSAEKLLKNKKSVYEQDGVSYERNKKRDVRNWYRGNDKYREERFDVRNTNTR
GDIPIMHGDCDENLARSLNELIQMVRELREEVRRQREEIQQLRSLIENCAGCQKAPEPMR
ESCQHNNPCFPGVHCYDTQSGMRCGHCPRGYVGDGITCKPGVTCAERPCFSGVQCYDTTE
GAQCGPCPDRFEGDGKTCRMRNPCDDHLCAAGVQCTMIEHAPYYKCGACPVGFKGNGTVC
HDIDECDLIEPCDVRVRCTNLVPGFRCEPCPPGFTGLHSGGLHAATFEYALQRQRCNDID
ECADGSARCGPNSVCINTEGAFECQCNRGYVRNSTYGCFAVEGMCLDGTVCDKNAVCRHA
GSNTYKCKCKVGWAGDGFHCGPDRDLDGWADFDLGCADSRCRQDNCVYVPNSGQEDADKD
GIGDACDQDADNDGVMNSPDNCPLVHNPDQLDTDKDGGDKQGDACDNCPTIANIDQHDVD
GDGIGDACDPDIDNDGILNERDNCPKKANSNQLDSDGDGIGDVCDNCPAVSNVNQMDSDN
DLIGDACDSDIDRDRDGVQDSRDNCPKLANSDQLDTDGDGRGDLCDPDADNDGILNAEDN
CPIVYNPDQMDANNDGVGDICEEDFDLDKIPNYLDNCPNNSKIFSTDFRTYQTVVLDPEG
DSQIDPNWVIYNKGAEIVQTQNSDPGLAVGYDAFGGVDFEGTFFIDTEIDDDYVGFIFSY
QDNHKFYAVMWKKNIQTYWQATPFRASAEPGIQLKLIDSNTGPGQMLRNSLWHTGDTKDQ
VKLLWKDPRNVGWKERTAYRWLLLHRPKIGLIRLRVFDGEKMVADSGNIYDSTLKGGRLG
VFCFSQEMIIWSDLVYRCNDNVPEAIYRELPPRLQKEVQIDYKT
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
aacaacatgaggaaaattttactattgttttgcatagcatggttttcaaatgaaggatta
tcattatcactcgatccagttgcttccaacgaacttgaaacgcatataaaaaatgatttc
atcatttctctcaggcatatcaggcctcgaagaaagttccgtttatcgatagaggcactg
tttatgatcgatttccccacagcaaagaacaagttttcattctatttagaccgcaaaggc
aaacgagtaactgtggatattaattcaaatgccaatacatattctaagtaccttgaaatt
cctggaatgaatgagacaactactattcgatcattggctatcttgtttagtcacaactcg
ttggtactcttcatagactgcaaagaaggagcgagattagatttagacatcgatatatcg
aaactgtacctgaaccaggatgatcctaatgtgaaactatttagggaacgcaaataccca
ctacatttggattcatctgttgaaaatgcactctctaggacaagttgtcagaatttgctt
aaacgaaagcataccaaaaaaaccggatctgctgaaaaacttcttaaaaacaagaaatcg
gtctacgaacaagacggcgtatcctatgaacggaataaaaaacgagatgtgcgaaattgg
tatcggggaaatgacaaatatcgagaggaacgcttcgatgtaagaaataccaatacaaga
ggagacataccgatcatgcatggcgactgcgatgaaaatcttgccaggtcactcaatgaa
ctaattcaaatggtccgggaactgcgtgaggaggtcagaagacaacgggaagaaattcag
cagcttagaagtttgattgagaactgcgcgggttgccaaaaagctccagaacctatgaga
gaaagttgccaacacaacaatccatgtttcccaggtgtgcattgctacgatactcaatcc
ggtatgaggtgtggacactgtcctcgaggatatgtaggagatggcattacctgcaaaccg
ggagtaacttgtgctgaaagaccttgtttctccggtgtccagtgttacgatactactgaa
ggcgcacaatgtggaccctgtccagatcgttttgaaggagatggcaaaacctgtcgaatg
agaaacccttgtgacgatcatctctgtgctgcaggtgtacaatgcactatgattgaacat
gcaccatattacaagtgtggagcgtgccctgttggattcaaaggaaatggaactgtgtgt
catgatatcgatgagtgcgatcttattgaaccgtgcgatgtgcgggtacgctgtacaaac
ttagttccaggcttccgatgcgaaccttgcccaccgggttttactggattacacagcggt
ggtttacacgcggcaacttttgaatacgctctccaaagacaaagatgcaacgatattgat
gaatgcgccgacggatccgcgcgttgtggtccaaactcagtatgtattaacactgaaggt
gcattcgaatgtcagtgcaataggggttacgttcgtaactctacctacggttgtttcgct
gtagaaggaatgtgtttagatggtacagtttgcgacaaaaatgccgtatgccgtcatgct
ggtagcaacacatataaatgtaaatgtaaggttggatgggcaggtgatggatttcactgt
ggtccagatagagatttagacggatgggcagatttcgatctaggatgtgctgacagtaga
tgtcgccaggacaattgtgtgtatgttccgaattcaggccaagaagatgccgataaggat
ggtataggagatgcctgtgatcaagacgccgacaacgatggtgtgatgaatagtcctgat
aattgtccattagtacataacccggatcaactggatactgataaagatggaggagataag
cagggtgatgcttgtgataactgcccaaccattgcaaatatcgatcaacacgacgtagat
ggagatggaattggtgatgcatgcgatccagatatcgataatgatggaattctgaacgaa
cgggataactgtccgaaaaaggcaaactctaaccagttagacagcgatggtgatggaata
ggtgatgtctgtgataactgtcctgcagtttctaacgttaaccagatggactctgacaac
gatttaataggcgatgcgtgtgacagcgatattgacagagatcgagacggtgtacaagac
agtagggataattgcccaaagttggcaaattcggatcaattagataccgatggtgatgga
aggggagatttgtgcgatccagatgctgacaatgatgggatcctcaatgccgaagataac
tgcccaattgtgtacaatcccgatcaaatggatgctaataatgatggcgtgggtgatatc
tgcgaggaagattttgacttggacaaaataccaaactatttggacaactgtccgaacaac
tcgaaaattttttcaactgacttcagaacctatcagaccgttgtactcgatccagagggc
gattcacagatcgatcccaactgggtgatttataataaaggagccgaaatagtacaaacg
cagaacagcgatccaggattagcagtgggttatgatgcttttggcggtgttgatttcgag
ggcacatttttcattgatacggaaatagatgatgattacgttggatttatattcagttat
caagacaatcataaattttacgctgttatgtggaagaaaaatatacaaacctattggcaa
gcgacacctttccgtgcttctgctgaacctggaatccaattgaagctgatagatagcaat
acaggtcccggtcaaatgttaagaaatagtttgtggcacacgggtgatactaaggatcaa
gtaaaactattatggaaagatccgcggaatgttggctggaaagaacgcacagcttaccgt
tggttactgctacatcgtccaaaaataggtttgattcgcctaagagtgtttgatggcgaa
aaaatggtggctgactctggtaacatctatgattcaacgttgaaaggtggccgtctagga
gtgttttgtttctctcaagaaatgatcatttggtctgatttggtgtataggtgcaatgat
aatgttcctgaagcgatttacagagaattgcctccacgtctccagaaagaagttcagatt
gactacaaaacgtga

DBGET integrated database retrieval system