KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008078Help
Entry
AaeL_AAEL008078   CDS       T01053                                 

Definition
clk2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AaeL_AAEL008078
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   AaeL_AAEL008078
Spliceosome [BR:aag03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    AaeL_AAEL008078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 366 aa AA seqDB search
MFIHKTLQVCVRSDEITTGNKILATLGEGTFGRVVKVKDLEMEHTMALKVIKNVEKYREA
AKLEINALEKIAEKDPTFQHLCVKMLDWFDYHGHMCIAFEMLGLSVFDFLRENNYEPYPM
DHVRHMAYQLCYAVKFLHENKLTHTDLKPENILFVDSEFTTTFNGRKNREVRRVKCTDIR
LIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIMFELYLGITLFQTH
DNREHLAMMERILGTIPYRMARKTRTKYFHHGKLDWDEKSSAGRYVRDHCKPLHRYVLAE
TPDHLQLFDIIRRMLEYDPANRITLGEALRHPFFAKLPPAQRLHEKCNENSVSASSSRER
SHSLSR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttcattcataaaactttacaagtgtgcgtgagaagcgacgagataacaactggaaat
aaaatcctggccaccctaggcgagggaacgtttggcagggtggtgaaagtcaaggatttg
gaaatggaacacaccatggcactgaaggtgatcaagaacgtcgaaaagtaccgggaagca
gccaagctggagatcaacgccctggagaagatcgccgaaaaggatccaacttttcagcat
ttgtgtgtcaaaatgctggactggttcgattaccatggtcacatgtgcatcgcgttcgaa
atgctggggctcagtgttttcgactttctaagagaaaacaactacgaaccctacccgatg
gatcacgtgcggcacatggcctaccagctgtgctacgcggtcaaattcctgcacgaaaac
aaactcacccacacggatctgaagccggagaatatcctgtttgtggactcggagttcacg
acgacgttcaacggccgaaagaaccgtgaggtccgccgcgtcaagtgcaccgacattcgg
ttgatcgactttggcagtgccacgttcgatcacgagcaccacagtacgatcgtgtcaacg
cgccactaccgggcgccggaagtaatcctggagctgggctggtcgcaaccgtgcgacgtc
tggtcgatagggtgtataatgtttgaactgtatctgggcattacgctatttcaaacccac
gacaacagggaacatctggctatgatggagcgtatattgggtacaattccttaccgaatg
gccagaaaaacccgcaccaaatacttccaccacggaaagctcgactgggacgagaagtcg
tcggcggggcggtacgtgcgcgaccactgcaaacccctgcaccggtacgtgctggcggag
acgcccgaccacctgcagctgttcgacatcatccgacgcatgctggagtacgatccggca
aacagaatcacactaggtgaagccctgcggcatccgttcttcgcaaagctcccgccggcg
cagcgtttgcacgagaaatgtaatgaaaattccgtctcggccagtagtagccgggagcgt
tcccatagtttatcgagatga

DBGET integrated database retrieval system