KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008246Help
Entry
AaeL_AAEL008246   CDS       T01053                                 

Definition
phospholipase c epsilon
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AaeL_AAEL008246
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AaeL_AAEL008246
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AaeL_AAEL008246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1022 aa AA seqDB search
RHEPEAAHRIENCMSFEGFARYMMDKDNYAFLSELMPESTYMNLPLSQYYIASSHNTYLT
GHQLKGESSVELYSQVLLTGARCVELDCWDGDDGTPVIYHGHTFTTKIPFRAVVEAINKS
AFVQSAYPVILSIENHCSVTQQQRMAAIFQAIFGEKLVTNFLFDQDYTDEPYLPSPLSLK
HKILIKNKKLIVEVPATLSTGLTRQNTYKQSNLSSRASSIISNTSGSSLNEEFSDDEYED
DDDFDNIDGKLQNINKIKLEHDKSRHSVSHANVSTPTRQRIEQQQQHQQLIQPQQQQHHQ
SDDRSRKRSNQIARELSDLVIYIQAIKYRGLNPYSPHNSMRANPRQPLKTSGSNSSGDTL
SLPSSGHLSDNLSLSYDTSSISGSESVLPTPARTRTMPNANHPCYQCSSLNEASAKKLCR
KDPLGLIAHTETQLMRTYPAGLRIDSSNFNPVFFWSFGFQMVALNYQTEDMPMHINKAMF
EENNSCGYVRKPDVLWNRSHLMYRRFNPLEKEFDGLHVTQLVINVVSGQYLNHVTGGNVI
HVEIELLGIPIDCGRRRTKPVKHNLFNPVWNETFFFKIMFHDLAFLKFTVYESESVVVAQ
RVISLKCFRPGYRHVRLRSPINQPLNMASLFLRTANRKEQFEDNEPILESKVPLLKRKTF
FCTIYDAVPNNPFTILKITQECTTKDVLMMVLQKMRKPRTDIANYILIEEVYTGWEKKDK
RYPPTQRVLDMVEKPLQSQASWRGDGRFILKRIGNDPSSRAWVTSIHDPLALENVDNFLV
CVFNVSHDIPYAILRVPIKSTAQDVLAQALLKARRLDNPNNFVLVEELNYSNKSNDTMQR
ILLDDENVYTTQANWKSIGRFVIHERSQLTPSTIRKTILPIEKISRGFSISRGSSSSSTS
VHSLASKSPIQVALSDPTTSRVKCRSADAAALGTKPKHSRNSASGASGGGGSGGRHKYNS
EKDTSFSSTSSSSNATSKSSNRREVHSEGETLSDDESKDHDILSTMSRFKRMSIKKLKSW
KS
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
cggcacgagccagaagctgcccaccgcatcgaaaactgtatgagcttcgaaggctttgct
cggtacatgatggacaaggataactatgcgtttctcagtgagctaatgcctgaaagtacc
tacatgaacttgccgctgtcacagtattacattgcatcgtctcataatacgtacttaacc
gggcatcaactgaagggtgaaagttctgtagaactatacagccaagtgctgttgacaggt
gctcgatgcgttgaactggactgctgggatggcgatgacggaacaccggtcatttaccat
ggacatacgttcaccacaaagattccattccgagcagttgtagaagcaataaacaaatca
gccttcgtacagtctgcatatccggtcattttatcgatagaaaaccactgctcggtaacg
cagcagcagagaatggccgctatttttcaagccatttttggagaaaaactagttacaaat
tttctattcgatcaggactacacagacgaaccatatctgccctcacctctatcactgaaa
cacaaaattctgatcaaaaacaaaaaactgatagtagaagtgccagccacgctctcaact
ggtttgacccgtcagaatacgtacaaacaatcaaatctctccagtagagcgagttcaatt
atatcaaacactagcggtagctccctcaacgaagaattcagcgacgatgaatacgaggat
gatgacgattttgacaatattgatggtaagttgcaaaatattaataaaattaagttagaa
catgataagtctagacatagtgtgtcccacgcgaatgtttctacaccgacacggcaacgc
atcgaacagcaacagcagcatcaacagctcatccaaccacagcaacagcagcaccatcaa
tccgacgatcgatcccggaagcgtagcaatcaaattgctcgcgagctttcggatttggtg
atctacatccaagcaataaagtaccgaggactcaatccgtacagtccacacaactcaatg
cgtgccaatccgcgacaaccgctcaaaaccagtggaagtaacagttcgggagacacacta
agccttccatcatctggtcacttatcggataatctatctctcagctacgacacatcaagc
atcagcggaagtgagagtgttctaccgactcctgcgcgaacacgaaccatgccaaacgcg
aaccatccctgttaccaatgttcatcgctgaacgaagctagcgctaagaaactctgcagg
aaagatcctttgggactgattgcacacaccgaaacccaactgatgaggacctatccagcg
ggactgcgaattgactcgtctaacttcaatccggtgttcttctggtcgtttgggtttcaa
atggttgctctgaattaccaaacggaggacatgcccatgcatatcaataaagccatgttc
gaggaaaacaacagttgtggatatgtccgcaagccggatgtactgtggaacaggtcacat
cttatgtacaggcgattcaatcctttggaaaaggaatttgatggactgcacgtaacgcaa
ctagtgatcaacgtggtgtccgggcaatatttgaaccatgtcacgggtgggaatgtgatt
catgtggaaatagaacttcttgggattcctatcgactgcggaagacggcgaacgaaaccg
gtgaaacacaatctgttcaatccagtttggaacgaaaccttcttcttcaaaataatgttc
cacgacttggcgttcctgaagtttactgtttatgaatcggaatcggtagttgtggcgcaa
cgcgtgatatcactcaaatgctttaggcctggttacagacacgtgcggttgcggtctccg
atcaatcaacccttgaatatggcatcattattcctacgaactgcaaacaggaaggagcaa
ttcgaagataatgagcccattttggaaagtaaagttcctttgttgaagcgcaaaacgttc
ttttgtactatttacgatgcggtacctaacaatccatttacaattctcaaaattactcaa
gaatgcacaacgaaagacgttctcatgatggtgttgcagaaaatgcgaaaaccgagaacc
gatattgccaactacatattgatagaggaagtttatacaggatgggagaagaaggacaaa
cgatatccaccaacgcagagggtgttggacatggtagagaaaccgttgcaatcgcaggcc
agctggagaggtgacggaaggttcatactgaaacggatagggaacgacccaagcagtcga
gcgtgggtaacatcgattcatgacccgttggctctagaaaatgtggacaattttctggtc
tgcgtgttcaacgtatcacatgacataccgtacgcaattcttcgagtaccaatcaaatct
actgcgcaagatgttctcgctcaagctctgttgaaagcgcgccgcctcgataaccccaac
aactttgtgctagttgaagaattgaactacagcaacaaaagcaatgatacaatgcagcga
attctgttagatgacgaaaatgtctatacaacgcaagcgaattggaaatcgatcggacga
ttcgtcattcacgagcgaagtcaactcacgccttcaacgatccgtaaaacgatactgccg
atcgagaagatcagcagaggcttcagcatcagtcggggatcgtcttcgtcgtccacttcg
gtgcactcattggcctcaaagtctccgatccaggtggcgctcagcgatccaacgacgtcc
cgggtcaaatgccgctctgcggatgcggctgcattggggacgaagccgaagcactcccgc
aattccgcgtctggggcttcgggaggtggaggatccggcgggcggcataagtacaactcg
gagaaggacacttcgttttcgagtaccagcagtagcagcaacgctacatccaagtctagc
aatcgtcgggaggtgcactccgagggggagactctcagtgacgacgagagcaaggatcac
gacattctgtcgacaatgtcacgcttcaagcggatgtctatcaagaagttgaaatcctgg
aagtcgtaa

DBGET integrated database retrieval system