KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008379Help
Entry
AaeL_AAEL008379   CDS       T01053                                 

Definition
P38 mapk
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aag04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 358 aa AA seqDB search
MPQFYKVEINKTEWEVPQKYQMLTPVGSGAYGQVCSATDTQHNVKVAIKKLARPFQSAVH
AKRTYRELRMLKHMNHENIIGLLDVFHPGGNTLDSFQQVYLVTHLMGADLNNIIRTQRLS
DDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYV
ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDHLTRIMFFCGTPD
DELMQKITSEEARHYIRSLPKTEKRNFSDVFRGANPLAIDLLEKMLELDADKRVTAEQAL
AHPYLEKYADPTDEPTSSLYDQSFEDMDLPVEKWKELVFQEVLNFVPQQHAHIGSDGQ
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccacagttctacaaagtagaaatcaacaaaacagaatgggaggtaccgcagaagtac
caaatgctcacccctgtaggaagtggggcttacgggcaagtctgttctgcaacggacacc
caacacaacgttaaggtggcaatcaaaaagctggcgcgccctttccagtccgcagtccac
gccaaacgaacctatcgtgaactccgcatgttgaagcacatgaaccacgagaacataatt
ggcctgctggacgttttccatcccggaggtaacacactggactccttccagcaggtctac
ctggtcacccacctgatgggggcggacctgaacaatattatacgaacacaacgtctctcg
gacgaccatgtacaatttctagtctatcagattctacggggccttaaatacattcacagt
gccggtattatacacagggatttgaagccgtccaacatagcagtgaacgaggattgtgag
ctgaaaattctagactttggtctggcccgccccacagagaacgaaatgaccggttacgtg
gcgactcggtggtaccgggcgccggaaatcatgctcaactggatgcactacaatcaaacc
gtggacatttggtccgtcgggtgcatcatggccgaactgttgacgggtcgaacgcttttc
cccggcacagaccatatcgaccaccttacacgcatcatgttcttttgcggaacacctgac
gatgaactgatgcaaaaaataactagcgaagaggctagacactacatccgatcattgcct
aaaacggaaaagcgcaacttcagcgatgtgtttcgtggtgccaatcctcttgccattgac
ttgctggagaaaatgctggaactagacgcagataagcgtgttaccgccgaacaagcgttg
gcacatccatatttagagaagtacgcggaccccaccgatgagccaacgtcttcgctgtat
gatcaaagctttgaagacatggatctacccgtggaaaaatggaaggaactcgtcttccaa
gaagtacttaatttcgtccctcaacagcatgcacatattggcagtgatggacagtaa

DBGET integrated database retrieval system