KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008397Help
Entry
AaeL_AAEL008397   CDS       T01053                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aag00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aag00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 217 aa AA seqDB search
MFLLRLLTRPASSASNRTAAFGLFGTAMVAINLLSTSSVLACPSSQSKKTASGNEPSSVY
DFSAVDIDGNKVDFERYRGHVLIIVNVASKCGYTAGHYKELNELYEEYGETEGLRILAFP
CNQFGNQEPGTNEEIKHFARVEKGAKFDLFAKIYVNGDEAHRLWQFLKQRQGGTLFDAIK
WNFTKFIVDKNGQPVERHGPQTSPLQLRDNLKKYFAQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgttgcgacttctaacccgtccggcgtcttccgcatcgaaccggacggcagcg
tttggccttttcggtacggccatggtggcgataaacctgctttcaacatctagcgttttg
gcgtgtccctcatcgcagagcaagaagacggcgtctggcaatgaaccttcgtcggtctac
gatttcagcgcagtggacatcgatggcaataaggtggatttcgagcgctaccgaggtcac
gtgctgatcatcgtcaatgtcgcctccaagtgtggctataccgctggccattacaaggag
ctgaacgaactgtacgaagaatatggcgaaacggaaggtcttcgaattctagcgttcccc
tgcaaccagttcggtaaccaggaaccgggaaccaacgaggagatcaaacacttcgcccgc
gttgagaagggagccaagttcgatctgttcgccaagatatacgtcaacggggacgaggcg
catcggctgtggcagttcctgaagcaacgccaaggcggtacgctgttcgatgccatcaag
tggaacttcaccaagttcatcgtggacaagaatgggcaaccggtggaacgacatggaccc
cagaccagcccgctgcagttgcgggacaatttgaagaagtactttgctcaatga

DBGET integrated database retrieval system