KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008510Help
Entry
AaeL_AAEL008510   CDS       T01053                                 

Definition
sphingosine kinase a, b
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AaeL_AAEL008510
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     AaeL_AAEL008510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 647 aa AA seqDB search
MVDKPKIDLGTEEIVNPSPTISKGTDCGSPPHVVYLTETFYISSKKNTVFEVRLTDKGLS
LKKQSNGSTKEQTIPLKDIIGCRCLRSKRKGKGSSACACTSISGTAQLKVVEENSGEQDE
SDVSAYLYIYAYILKRNRRGGFRERTTITLRFRSFDKYEDNNKEAQKWRAAIKYLVAGET
SIRPTYQPKETRKMLVVLNPKSGSGKAREMFQQRVAPVLAEAEISYDLHITKKPDWAREF
VRNRDIYLWRGIVVVGGDGIFYEVLNGLFEREDWQTAIDELAIGIIPCGSGNGLAKTIAH
LYDEPFETKPILASALTMVKGKHSMLDIVRVETRSQIMFSFLSVGWGLISDIDIESERLR
AIGGQRFTLWSVHRLISLRTYQGKVSYIPALVSNMNRSNSLPREGGGGGGGGVGLLKHSI
SYNTTLDCHDCRSGGGGGPNDSHSNCDACDTNFSDVLSLETGSNLDTFRPRIDSWYSATS
RKSTYFSTVDSIYESDRASNEGAPTGTNVVQMYGPPSRLPALTASLSDSWKTIDGEFVMV
HAAYQTHLSTDCYFAPLSKLNDGIIWLLIIRAGVSRSQLLSFMLGLSSGSHIPTQANQYI
QMIPVTAFRIEPSGSTPGHMTVDGENVEYGPIQAEIFPSLAKVMVPK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggttgataaaccgaaaatcgacctcggaacggaggagatagtcaacccgtcgccaacc
atcagcaagggaacggactgtggcagcccgccgcacgtggtctacctgacggaaacgttc
tacatcagttccaagaagaataccgtcttcgaggtacgcctaaccgacaaagggctcagc
ctcaaaaagcaaagcaatggttcgaccaaggaacaaacgatcccgctcaaagatatcatt
ggctgccgctgcctccgaagtaaacggaaaggcaagggaagctcggcttgcgcatgcact
tccatatcggggaccgcccagctcaaagtggtcgaagaaaactccggcgagcaggacgaa
tccgacgtcagtgcgtatctctacatctacgcgtacatcctgaaacgaaaccgacggggt
ggatttcgggagcgcacaaccataaccctgcggtttcgttccttcgacaagtacgaggac
aacaacaaggaagcacagaaatggcgagccgcgatcaagtatctcgtcgcaggggaaaca
tccatcaggcccacatatcagccgaaggaaacgcgcaaaatgctggttgttctgaacccg
aaatcgggttccggcaaggcgcgggaaatgttccagcaacgggtggcgccggtcctggcg
gaggcggaaatttcctacgatctgcacataacgaaaaaacccgactgggccagggagttt
gtccggaaccgggacatctacctctggcgggggatagtggtggtgggtggggatggcatc
ttctacgaggtgctgaacgggctgttcgagcgagaagactggcagacggcgatcgacgaa
ttggcgatcggaatcattccgtgcggttccggcaatggactggccaaaaccattgcgcat
ttgtatgacgaacccttcgaaacgaaaccgatcctggcctcagctttaaccatggtcaaa
ggcaaacattccatgttagatatagttagagtggagacacggtctcaaataatgttctca
ttcctgtcggttggctggggcctaatctcggacatcgacattgagagcgagcgactgcgg
gccatcggtggccaacggtttacactttggtccgtccatcggctaatcagcctacgtacc
tatcagggcaaggtgtcgtacattccggcactagttagtaatatgaatcggtcaaactcg
ttgccacgggaaggtggtggtggcggcggtggcggcgtaggattactgaagcacagtata
agttacaacaccaccctggattgccatgactgtagaagtgggggaggtggtggacctaac
gatagccacagcaattgtgatgcctgcgatacaaattttagcgacgtgctatcgttggaa
acgggtagtaatctggatacgttccgacctcggatcgacagttggtactcggcaacgtcc
cggaagagcacgtacttttccaccgtggatagtatatatgagagtgaccgtgcttccaac
gaaggtgcccctacaggtaccaatgtggtgcagatgtatggaccaccttccaggcttcca
gcactgactgcgtccctgtccgacagctggaaaaccatcgacggggagttcgtaatggtg
catgcggcctaccagacgcacctcagtacggactgctacttcgctccgctgtccaagctg
aacgatggcatcatatggctactgatcatcagggccggggtaagtcggtcccagttgctg
tcgttcatgctgggcctgagcagcgggtcccacattccaacgcaggccaaccagtacatc
cagatgattccagtgacggcattccggatcgagcccagtgggtccacgccgggtcacatg
accgtggacggcgaaaacgtggagtacggaccaatccaggcggagatctttcctagttta
gccaaagttatggtaccgaaatga

DBGET integrated database retrieval system