KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008559Help
Entry
AaeL_AAEL008559   CDS       T01053                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AaeL_AAEL008559
   00330 Arginine and proline metabolism
    AaeL_AAEL008559
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AaeL_AAEL008559
Enzymes [BR:aag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AaeL_AAEL008559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 686 aa AA seqDB search
MLKMHNLRSRCNTTVQLFTSNFQFGIRATVAVSNNLSTLAEAKHTPLHPIQWRTHPHEKY
NRRIFGKNHPISLKLYSDDHRRNIHDSAVIHVPVLPNKIYSKRAAFYKDYANDGYNNAKE
QRDADKKHAEDLLFDMFKNEDTGLLNIGKFLAALRTTGIRRNDPRIGEMMENLKKVHKLN
NYDGGSPLTQNLNAETFKAVIAPNIVLIARAFRHQFVIPDFQGFTKDIEEIYWKCKSNTD
GKVASYIPQLARVNPDYWGVSICTVDGQRFSMGDSNVPFTLQSCSKPLTYAIALEKLGSD
VVHQYVGQEPSGRNFNELVLDYNKKPHNPMINAGSILTCSLLKTLVHPEMTLAEKFDYTQ
NWFSRMAGNESLGFNNAVFLSEREAADRNYALGFYMREHKCYPDKANLRECMDFYFQCCS
MEANCETLSIMAATLANGGICPLTEEKVLQSENVRDVLSLMHSCGMYDFSGQFAFKVGLP
AKSGVCGGVMLVIPNVMGIFMWSPPLDPLGNSCRGVQFCEELVNIFNFHLYDNLKHGSNK
KDPRRHRYETKGLSVVNLLFSAASGDVTALRRHKLSGMDITLSDYDGRTALHLACSEGHL
ECVKFLLEHCGVPHNAKDRWGNSPMDEAETFGHTDVVNYLKEWNEKVELVKKTDSETGYN
SDQDSMKSDKSTSSDESSKHPTDILK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaatgcacaatctcagaagtcggtgtaacaccacagtgcaacttttcacatcc
aactttcaattcgggatacgagctacggtggcggtcagtaacaatttgtccaccctagct
gaagctaagcacaccccattgcatccaattcagtggagaacacatcctcatgaaaagtac
aatcggaggattttcggaaagaatcacccgatatcgttgaaactctacagcgacgatcat
cgtcgaaacattcacgattctgctgtgattcatgtacctgttttacctaataaaatctat
agtaaacgcgcagctttctacaaagactatgcaaacgatggctacaataatgcaaaggaa
caacgagatgccgacaaaaagcatgctgaggacctgctgttcgatatgttcaaaaatgaa
gatacggggttgctcaatattggcaaattcctggcggctcttcgaacaactggaattcgc
agaaatgatccccgtatcggtgagatgatggaaaatcttaagaaggtgcacaaattgaac
aactacgatggtggatccccactgacacagaatcttaacgcagaaacgttcaaagcagtt
atcgcacccaacatcgtccttattgctcgagccttccgacaccagtttgtgattccagac
tttcagggctttacgaaagatatcgaggaaatttattggaagtgtaaaagtaacactgac
gggaaagttgcaagctatatacctcaattggctcgtgtgaatccagattactggggtgtg
agcatatgtacagtagatggtcaacggttctcaatgggagattccaatgtgccgtttact
ctacaaagttgcagtaaaccattgacatacgccattgctttggagaagctaggatcggat
gtcgtccatcagtatgtaggccaagaaccaagtgggcgaaactttaatgaattggtgttg
gattacaacaaaaagccccacaatcctatgatcaatgctgggtccattctaacatgctcg
ctgctgaagaccctagttcatccggagatgaccctagctgaaaagtttgactatacccag
aattggtttagccgtatggctggtaacgaatccttaggatttaacaacgcagtatttctg
tccgaaagagaagccgctgatcgaaattacgcccttggtttctacatgcgagagcacaaa
tgttatccggacaaagcaaatctccgcgaatgtatggatttctatttccaatgttgctcg
atggaagccaattgtgaaacgctttccataatggctgccaccctagcaaatggaggaata
tgtcccttaacagaagaaaaagtactacaatcggagaatgtaagagatgttttgtctttg
atgcactcatgcggaatgtacgacttttctggtcaattcgcatttaaagttggacttcca
gcaaaatctggcgtatgtggaggagtcatgttagtcattccaaatgtcatgggaattttc
atgtggtctccgccactagatccactcggtaacagctgtcggggtgttcagttctgtgaa
gaattggtgaacatttttaactttcatttgtacgacaatttgaagcatgggtcgaacaaa
aaggatccacgtcgtcaccgttatgaaactaaagggttatccgtcgtgaatcttctattt
tccgcagctagcggtgatgtaaccgcactaagaagacacaagctttcaggaatggatatc
acattatcggattacgatggcagaactgcactgcatttggcgtgttctgaaggacatctg
gaatgcgtgaaatttttactagagcactgtggtgttcctcacaatgctaaggatcgctgg
ggcaacagtcctatggatgaggctgagaccttcgggcacactgacgtagtgaattattta
aaagaatggaacgaaaaagttgaactggtaaaaaagacggatagcgagacgggctacaat
tcagatcaagacagcatgaaaagtgataaatctacatcgagcgatgaaagtagcaaacat
ccgacagatatcttgaagtga

DBGET integrated database retrieval system