KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008634Help
Entry
AaeL_AAEL008634   CDS       T01053                                 

Definition
jnk
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aag04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aag04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:aag04391]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aag04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 359 aa AA seqDB search
FEVPSRYIRLEAKGFGAQGMVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKL
VNHKNIIGLLNAFTPQRTLEEFQDVYLVMELMDANLCQVIQMDLDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMTRLQPTVRNY
VENRPRYTGYPFDRLFPDVLFPTDSNEHNRLKASQARDLLSKMLVVDPEHRISVDQALVH
SYINVWYDESEVNAPAPGPYDHSVDEREHTVEQWKELIYQEVMEYEARNNLTDGEGTPR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
tttgaggtcccttcgcggtacatcagactggaagcgaagggcttcggtgcccagggcatg
gtctgtgccgcgtacgacacaatcacccagcagaatgtcgccatcaaaaagctatcacga
ccgttccaaaatgtcacacatgccaaacgagcctacagggagtttaagcttatgaaatta
gtcaatcataaaaatattatcggactattaaatgcattcacgcctcaacgtacgctcgaa
gagttccaggatgtgtacctcgtcatggaactcatggacgccaatctgtgccaggtcatc
cagatggacctggaccacgagcggatgtcgtacctgctgtatcagatgctgtgcggcatc
aagcatctccactcggccggtatcattcacagggacttgaaaccttccaacatcgtggtg
aaatcggactgcacgttgaagatcctggactttggactggcccgtacggctggaacgaca
ttcatgatgacaccgtacgtcgtgacgaggtattaccgcgcaccggaggtcatcctcggc
atgggctacaaggagaacgtggacatctggtcggttggatgcatcatgggcgagatgatc
cggggaggagtgctgttccccggcacagatcacatcgatcagtggaacaaaatcatagaa
caactgggaactccgtcgccctcgttcatgacccggttacagccaacggtgcggaactac
gtcgagaaccgtccccgatacaccggctatccgttcgatcggctcttccccgacgtgttg
ttcccgaccgactcgaacgaacacaaccgcctcaaagctagtcaagcgagggatctgctg
agcaagatgttggtcgtcgatcccgagcaccgcatctccgtcgatcaggcactggtgcac
agctacatcaacgtgtggtacgacgagagcgaagtcaatgcgcctgcccccggtccgtac
gatcacagcgtagacgaacgcgagcacaccgtcgaacagtggaaggagctcatctaccag
gaggtcatggagtatgaggcccgcaacaatctgaccgacggggaaggtaccccgcggtag

DBGET integrated database retrieval system