KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL008853Help
Entry
AaeL_AAEL008853   CDS       T01053                                 

Definition
choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aag00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 416 aa AA seqDB search
MRDIAARICRDYLTGAWKTIPAEDLQLKRISGGLSNFLYYVRLPDQQNGSSPKSSNHCYK
RARKDSYSNMLEPKEVLLRIYGQTHGESALESMLTESVVFTLLSERKLGPKLHGIFPGGR
IEQYIPARALTTSELSDPKISLKIAEKMAAIHSLDIPVSKEPDWLWNTMNRWLKSVETTL
ETFRKDRTNGNKRIDGDEIITDLDLRAEVEWLKSVIDREDHPVVFSHNDLQEGNILLRED
YSPSTGLDNFCTLDQFDESAQLDSHFSSILISNSNGSTTASNSSKVDVNSSVDTGSDTVS
YGNRNPRKRSLDEPIENEMDSTRDSVLSSTSQSLSDQPCDGEPELMIIDFEYCAYNYRGF
DLANHFLEWTFDYTNSAAPYFFHRPEQYPSREQQVRTFSSRNALKNKLLLVLHPYC
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagggatattgcggccaggatctgccgggactacctgaccggtgcctggaagaccata
ccagcggaggatctccagctgaagcgcatcagtggtggtctttccaatttcctgtattac
gtcaggcttcccgaccagcagaatggcagttccccgaaatcctcgaaccattgctacaaa
cgtgcacgcaaggacagctattccaacatgctggaaccgaaagaggtcttacttcgcatt
tacggacagactcacggtgaaagcgcactggaatcaatgctcactgaatcggttgtattc
acgctcctgagcgagcgtaaactgggaccaaagctgcacggaatcttccccggtgggaga
atcgagcagtatataccggcacgtgcattaacgacctcggagctgagtgatccgaaaatt
tcgctcaagatcgccgaaaagatggcagccatccacagcttggatattcccgtctcgaag
gagccggactggttgtggaacacgatgaaccgttggctgaagagcgttgagacaacgctg
gagacgttccggaaggatcgaaccaatggtaacaaacggatcgacggcgatgaaatcatc
actgacttagacctgcgggcggaagtcgagtggcttaagtcagttatcgaccgtgaagat
catccagttgtattctcacacaatgatttgcaggaaggtaatatcctgttgagggaagac
tattcgccttcgaccggtttggacaatttctgcaccctggaccaattcgatgaatccgcg
cagttagactctcactttagctcaattctaatttccaattctaatggcagcactaccgct
tcaaatagcagcaaagtcgacgtgaatagttccgtcgatactggtagcgacactgtaagc
tacggaaatcggaatccaaggaaacgttcgttggatgaaccgattgaaaatgaaatggat
agtacaagagattcagtccttagcagtacctcacaatcactatccgaccaaccatgtgat
ggagaacccgagcttatgatcatcgactttgaatattgtgcctacaactatcgtggtttc
gacctggccaatcattttcttgagtggaccttcgactacaccaactcggcggcgccttac
ttctttcacaggccagagcagtaccccagcagggaacagcaggtacgtactttcagttcc
cggaatgcgttaaagaacaaattacttttagtattacatccttattgttag

DBGET integrated database retrieval system