KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL009074Help
Entry
AaeL_AAEL009074   CDS       T01053                                 

Definition
inhibitor of apoptosis 1, diap1
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:aag04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 401 aa AA seqDB search
MAGVMMAQVLSTPRDFTDNKVKEDNAYGHTATSVPISYHTEVARLESFRGWMVSFISKTE
LARYGFYYVGPNDMVKCYFCRVEIGLWEPNDNVLSEHLRWSPYCPLLRKRQTNNVPIDAS
FLDQLPEPSYDTCGIRIRENSVAENAYSSSDRSSSGSLTSPPSSLTSESSMASNGPVVQQ
LSAPVLPQQKLPEYPNYAIEAKRLESYEDWPKFMKQKPKELSDAGFFYTGKSDRVKCFSC
GGGLKDWEAEDEPWEQHAMWYSNCEYLKLMKGEAYIAHCLAKKESSSEENGSDVGPSNSP
QPSTSGVVSAATSSLQSSQSSSLSVSAEEDNTAMVGCSSDEDEPNRKLDTSRTCKICYVN
EYNTAFSPCGHVVACAKCASSVTKCPLCRKPFTNVMRIYLM
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctggagttatgatggctcaagttttatcaacacctcgagacttcacggataataaa
gttaaagaggacaatgcctacggacatacagcaacatcagtgccgatttcgtaccacacg
gaagttgcccggctcgagtcgttccggggctggatggtgtccttcatcagcaagactgaa
ctggcccggtacggtttctactacgtggggccaaatgacatggtaaaatgttacttctgc
cgagtggaaatcggtctgtgggagccgaacgacaacgtcctctcggaacacctgagatgg
tccccgtactgtccgctcctacgcaaacgacagacaaacaatgttccaatagatgccagc
tttctggatcagctcccggaaccaagctacgacacatgtggtattaggatacgagaaaac
tccgtagcggaaaatgcctattcctcttcggatcgaagcagtagtggttccctaacatcg
cctcctagctcgctaacgtccgagtctagtatggcatcgaatggaccagtcgttcagcaa
ctatcagcaccggttctgccccaacagaagctaccggaatatccgaactatgccatcgaa
gcgaaacgccttgaaagctacgaagattggccaaagttcatgaaacagaaacccaaggaa
cttagtgatgccggatttttctacactggcaaaagtgatcgggtcaagtgcttcagctgt
ggcggtggcctcaaagactgggaagctgaagatgaaccgtgggagcaacacgccatgtgg
tatagtaactgtgagtacctgaaactaatgaagggcgaagcatacatcgctcattgtttg
gccaagaaggaaagttcttcggaagagaacggctcagatgtgggcccgtccaactcgccc
caaccatcgacctccggagtagtctccgcagcaacatcctcgcttcagtcatctcagtcg
tcgagcttgagtgtatctgccgaagaagacaatactgccatggtcggctgcagtagtgat
gaagatgaaccaaatagaaaactagacaccagtcggacttgcaaaatctgttacgttaat
gagtacaatacggcattttcgccctgtggccatgttgtggcctgtgccaaatgcgcttca
tctgtcaccaagtgtccgttgtgtcggaaacctttcaccaatgttatgaggatttatctg
atgtga

DBGET integrated database retrieval system