KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL009074Help
Entry
AaeL_AAEL009074   CDS       T01053                                 

Gene name
IAP1
Definition
(RefSeq) AAEL009074-PA
  KO
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AaeL_AAEL009074 (IAP1)
Mitochondrial biogenesis [BR:aag03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    AaeL_AAEL009074 (IAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
AA seq 378 aa AA seqDB search
MAGVMMAQVLSTPRDFTDNKVKEDNAYGHTATSVPISYHTEVARLESFRGWMVSFISKTE
LARYGFYYVGPNDMVKCYFCRVEIGLWEPNDNVLSEHLRWSPYCPLLRKRQTNNVPIDAS
FLDQLPEPSYDTCGIRIRENSVAENAYSSSDRSSSGSLTSPPSSLTSESSMASNGPVVQQ
LSAPVLPQQKLPEYPNYAIEAKRLESYEDWPKFMKQKPKELSDAGFFYTGKSDRVKCFSC
GGGLKDWEAEDEPWEQHAMWYSNCEYLKLMKGEAYIAHCLAKKESSSEENGSDSSQSSSL
SVSAEEDNTAMVGCSSDEDEPNRKLDTSRTCKICYVNEYNTAFSPCGHVVACAKCASSVT
KCPLCRKPFTNVMRIYLM
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggctggagttatgatggctcaagttttatcaacacctcgagacttcacggataataaa
gttaaagaggacaatgcctacggacatacagcaacatcagtgccgatttcgtaccacacg
gaagttgcccggctcgagtcgttccggggctggatggtgtccttcatcagcaagactgaa
ctggcccggtacggtttctactacgtggggccaaatgacatggtaaaatgttacttctgc
cgagtggaaatcggtctgtgggagccgaacgacaacgtcctctcggaacacctgagatgg
tccccgtactgtccgctcctacgcaaacgacagacaaacaatgttccaatagatgccagc
tttctggatcagctcccggaaccaagctacgacacatgtggtattaggatacgagaaaac
tccgtagcggaaaatgcctattcctcttcggatcgaagcagtagtggttccctaacatcg
cctcctagctcgctaacgtccgagtctagtatggcatcgaatggaccagtcgttcagcaa
ctatcagcaccggttctgccccaacagaagctaccggaatatccgaactatgccatcgaa
gcgaaacgccttgaaagctacgaagattggccaaagttcatgaaacagaaacccaaggaa
cttagtgatgccggatttttctacactggcaaaagtgatcgggtcaagtgcttcagctgt
ggcggtggcctcaaagactgggaagctgaagatgaaccgtgggagcaacacgccatgtgg
tatagtaactgtgagtacctgaaactaatgaagggcgaagcatacatcgctcattgtttg
gccaagaaggaaagttcttcggaagagaacggctcagattcatctcagtcgtcgagcttg
agtgtatctgccgaagaagacaatactgccatggtcggctgcagtagtgatgaagatgaa
ccaaatagaaaactagacaccagtcggacttgcaaaatctgttacgttaatgagtacaat
acggcattttcgccctgtggccatgttgtggcctgtgccaaatgcgcttcatctgtcacc
aagtgtccgttgtgtcggaaacctttcaccaatgttatgaggatttatctgatgtga

DBGET integrated database retrieval system