KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL009307Help
Entry
AaeL_AAEL009307   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AaeL_AAEL009307
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     AaeL_AAEL009307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 1054 aa AA seqDB search
NSTSGGSSEKQSGFLCGVVEGFYGRPWTTEQRKDLFRKLKQWGMDSYIYAPKDDYKHRAY
WRELYTVEEADHLTGLITAAHEQNINFYYALSPGLDITYSSSKEIGILKRKLDQVSQFGC
KAFALLFDDIEPEMSKSDKEVFQSFAYAQVSVTNEIYNHLNCPRFLFCPTQYCSSRAVPT
VKQSEYLNTLGSKLIQSIDIMWTGPKVISKLLTVECIQEITEVIKRPPVIWDNLHANDYD
QKRVFLGPYSGRSPELIPLLRGVVTNPNCEFHANAIAIQTLAFWSKCSADTKISSSISSD
IKLETENEDGICQEDAPAFLSKNVYHPRLALKNAIANWLPEFYQEKEAWGPISKPQPALT
MVMPIIPIIPSVNTCMTLTSTNTTTTTSANTMAVPEVNTTQLQLFADVCSTVTSAPENVP
APIMNSLVSATKVITNDSLPNPMAAAVTNMSIPTTIPISSIPVPIMSIKAVEGVENDVAT
QGLIDKSKSESSEDSTDIKGKPLEEDAIIENDLEQKKINVEDEDAKVDEVFSSANPSGGT
CAEPMECGSNLTSPKHVMKTHFDDVMMSETTSVSNSNKSFISQTCSGSMQIESSDTSLTS
NAEMIEVNDKDITATDIMLLCDLFYLPFEHGSKALQLLTEFYWLKTNAVVLCKQRNRKTS
SSSNQSSCTNSEDCSHLNGTVAGAVITASTHSSELKDGCNKSEVQEWIRRAESFENVCQN
IFRLARKIARCANKELCYDLFSYVWDVVAVLSLLSAYVKWLALGHFPPNINSHTQGGYTW
FSKGWKETFMSGDQEPWVFRGGLVADLQRLIPLDAANDLFLYKLPETSAVNLYTFRPYCF
ADEANLYSVCYRTLHDGDEFIERCPENLRSVLADRYLGPFLTLTPQFCMVIEDNHSEVVG
YACAALDVKNFIRNLEQCWIPEMCLKYPLAILGQSPSEGNESPKDTANALPQMICDCITY
FHNFSEDYPTCVMNSHPSLLSCRILKPHIIEDETMCKRVITLLLAALRTHGTSFGTHVCV
NKTDRFLYQFYAKLGFVEIYRDEYDPVLYMGRSF
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
aattcgacttccggcggcagttcggaaaagcagtcgggcttcctttgtggtgtggtcgag
ggtttctacggtcgcccgtggacaaccgaacagcggaaggatctgttccggaagctgaag
cagtggggcatggactcgtatatttacgccccgaaggatgactacaaacaccgggcttac
tggagggaattgtacaccgttgaggaagctgaccatcttacgggcctgatcacggctgcc
cacgaacagaacatcaatttctactacgctctctcgccgggactggacattacgtacagt
agcagtaaggagattggcattctcaagcgaaagctggatcaagtttctcaattcggatgt
aaagcttttgctctgctgttcgacgatatcgagccagagatgagcaaatccgataaggaa
gtgttccagagtttcgcctacgctcaagtttcggtcaccaatgaaatctacaatcacctg
aactgtccacggttcctgttctgtcccactcagtactgcagctcccgagccgttccgacc
gttaagcaatccgaatatctcaacacgttgggatccaagctcatccagagcatcgacatc
atgtggaccggcccaaaggtcatctccaaactgctcaccgtcgaatgcatccaggagatt
accgaggtcatcaaacggcctcccgtcatctgggacaatctgcacgcaaacgactacgac
cagaaacgtgtcttcctgggtccatactcgggacggtcccccgagctgattccactgctc
cgcggtgtcgtaacgaacccaaactgtgaattccacgccaatgccatcgccatccagacg
cttgccttctggagcaagtgcagtgcggacaccaaaattagttcgtccatttcgtcggac
attaagttggaaacggaaaatgaggatggaatctgccaagaggatgcgccggctttcctc
tcgaagaatgtataccacccacggctggcactgaagaacgccattgccaattggttgccg
gaattttaccaagagaaggaggcctggggaccgatcagcaagccgcaaccggcgcttaca
atggtaatgccgatcattccgattattccctctgttaacacctgcatgaccctaacgtcg
accaacacaacaaccacaaccagtgcaaataccatggcggtgccggaagtaaacacgact
cagctgcagttgttcgccgacgtttgcagtacggtgaccagtgctccagagaacgtaccg
gcacctattatgaactccctggtatccgccaccaaggtcattaccaacgattctttgcca
aatccgatggcagccgcagtgaccaacatgtctataccgacgacaattccgatctcgagc
attccggtgccaatcatgagtatcaaggctgtcgaaggagtggaaaatgatgtcgccacg
caaggcctgatagacaaatctaaatctgaaagcagcgaagattcaacagacattaaggga
aagccattggaagaagatgccattattgaaaacgacttagagcagaaaaagatcaacgtc
gaagacgaagacgctaaggttgacgaggttttcagtagcgcaaacccttcaggcgggacc
tgtgcagaaccgatggaatgcggcagcaatctgacttcgccgaaacacgtgatgaagacg
catttcgatgatgtaatgatgtcggaaaccacatcggtaagcaatagtaacaaatctttt
atttcacagacttgttcaggaagtatgcagatagaaagttcggatacttcattaacttct
aacgcagagatgattgaagtcaatgacaaggacatcaccgccaccgatattatgctactc
tgtgatctattctatctaccgttcgaacacggtagcaaggccctccagctgctcacggaa
ttctactggctgaaaaccaatgccgtcgttttgtgcaaacagcgtaaccgtaaaacaagt
tctagttctaatcaatccagctgcacaaactccgaggactgcagccatctgaatggtacc
gtggcaggggctgtcatcactgcatcgactcactccagtgaactcaaggatggatgcaac
aaaagtgaggtccaagagtggatccggcgagctgagtcgtttgaaaacgtctgtcagaac
atctttcgcctggcgcgaaaaattgcccgctgtgccaataaggaactttgctacgatctg
ttttcgtatgtttgggatgtcgtggcagtgctttcgctgttgagcgcctacgtaaagtgg
cttgcattgggccatttcccaccaaatatcaactcgcatacccaaggaggatacacctgg
ttcagcaaaggatggaaagaaacgttcatgtcaggtgaccaggagccatgggtgtttcgt
ggtggactggtggcagacttgcagcgtctcatcccattggatgccgccaacgatctcttc
ctgtacaaacttcccgaaacgtccgccgtgaacctgtatactttccggccctattgcttc
gcagacgaagccaatttgtacagcgtgtgctaccgaacactgcatgatggagacgaattc
atcgaacgttgcccggaaaacctacgaagtgttttggccgaccgctatctggggccattc
cttacgctaacaccgcagttttgtatggtaatagaagacaaccattcggaggtcgttggc
tatgcatgtgcggcactggatgtgaaaaacttcattcgaaaccttgaacaatgttggata
ccggaaatgtgtctgaagtacccattagctatcttgggtcagtcaccctccgaaggaaac
gaatccccgaaagacacggccaatgcgttgccacaaatgatttgtgactgtattacatat
ttccataacttcagcgaagattatcctacctgtgttatgaattcgcatccttcgttgctt
agctgtcgcattttgaagccgcacataatcgaagacgaaaccatgtgcaaacgtgtcatc
actcttttgctggcagcgcttcgaacgcatggaacttcttttggaacacatgtttgcgtc
aacaagacggatcgcttcctgtatcagttctacgccaagctcggatttgtcgaaatttac
cgcgacgagtacgacccggttctctacatgggacgaagcttctga

DBGET integrated database retrieval system