KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL009324Help
Entry
AaeL_AAEL009324   CDS       T01053                                 

Definition
hydroxyacyl dehydrogenase
Orthology
K08683  
3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AaeL_AAEL009324
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AaeL_AAEL009324
    1.1.1.178  3-hydroxy-2-methylbutyryl-CoA dehydrogenase
     AaeL_AAEL009324
Mitochondrial biogenesis [BR:aag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    AaeL_AAEL009324
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AaeL_AAEL009324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 255 aa AA seqDB search
MLKNAVALVTGGASGLGRATVERFARTGSKVVLCDLPTSKGGDVAKELGDNVVFVPVDVL
SEKDVTGALDIAKTKFGRLDVTVNCAGVAVAVKTYNFNKKAAHKLEDFQRVLLVNTAGTF
NVIRLSAGLMGENEPNQDGQRGVIVNTASVAAFDGQIGQAAYAASKAAVVGMTLPIARDL
STQGIRICTIAPGLFNTPMLQALPEKVRAFLAKTVPFPQRLGEPSEYALLVESIVENPML
NGEVIRLDGALRMMP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaacgcggtagctctggtgactggtggcgcctccggcctgggacgcgcaacg
gtggagcggttcgccaggactggaagtaaagtagtgctgtgcgatctccccacgtccaag
ggtggcgacgtcgcgaaggaactcggcgacaatgtcgttttcgtgccggttgatgtcctc
tcggaaaaggacgtcaccggtgcgctggacatcgccaagaccaaattcggccgtttggat
gtgaccgtcaattgtgccggcgtcgccgtagccgtcaagacctacaacttcaacaagaaa
gccgcccacaaattggaggacttccagcgggtgctgctggtcaacacggccggaacgttc
aacgtgattcggctgtccgccggcctgatgggcgaaaacgaacctaaccaggacggccag
aggggtgtgatcgttaataccgcctctgtggccgctttcgatggacagatcgggcaggcg
gcatatgctgcttccaaggccgcggttgttggaatgactctaccgattgcccgtgacctc
agcacccaaggtatccgcatctgcacgattgctccgggactgttcaacaccccgatgctg
caagcccttccggaaaaggttcgtgccttcctggccaagaccgttcccttcccgcagcgt
ctcggcgaaccgtcggaatatgcgctgctggtggaatcgatcgtcgaaaaccctatgctg
aacggagaggtgatccgactggatggtgccctgagaatgatgccttaa

DBGET integrated database retrieval system