KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL009324Help
Entry
AaeL_AAEL009324   CDS       T01053                                 

Definition
hydroxyacyl dehydrogenase
Orthology
K08683  
3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:aag00280]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 255 aa AA seqDB search
MLKNAVALVTGGASGLGRATVERFARTGSKVVLCDLPTSKGGDVAKELGDNVVFVPVDVL
SEKDVTGALDIAKTKFGRLDVTVNCAGVAVAVKTYNFNKKAAHKLEDFQRVLLVNTAGTF
NVIRLSAGLMGENEPNQDGQRGVIVNTASVAAFDGQIGQAAYAASKAAVVGMTLPIARDL
STQGIRICTIAPGLFNTPMLQALPEKVRAFLAKTVPFPQRLGEPSEYALLVESIVENPML
NGEVIRLDGALRMMP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaacgcggtagctctggtgactggtggcgcctccggcctgggacgcgcaacg
gtggagcggttcgccaggactggaagtaaagtagtgctgtgcgatctccccacgtccaag
ggtggcgacgtcgcgaaggaactcggcgacaatgtcgttttcgtgccggttgatgtcctc
tcggaaaaggacgtcaccggtgcgctggacatcgccaagaccaaattcggccgtttggat
gtgaccgtcaattgtgccggcgtcgccgtagccgtcaagacctacaacttcaacaagaaa
gccgcccacaaattggaggacttccagcgggtgctgctggtcaacacggccggaacgttc
aacgtgattcggctgtccgccggcctgatgggcgaaaacgaacctaaccaggacggccag
aggggtgtgatcgttaataccgcctctgtggccgctttcgatggacagatcgggcaggcg
gcatatgctgcttccaaggccgcggttgttggaatgactctaccgattgcccgtgacctc
agcacccaaggtatccgcatctgcacgattgctccgggactgttcaacaccccgatgctg
caagcccttccggaaaaggttcgtgccttcctggccaagaccgttcccttcccgcagcgt
ctcggcgaaccgtcggaatatgcgctgctggtggaatcgatcgtcgaaaaccctatgctg
aacggagaggtgatccgactggatggtgccctgagaatgatgccttaa

DBGET integrated database retrieval system