KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL009380Help
Entry
AaeL_AAEL009380   CDS       T01053                                 

Definition
phospholipase c beta
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aag00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aag04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:aag04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:aag04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1082 aa AA seqDB search
MTKRFEFNWQIPVPEALQAGCVFDRWYEDKDNNEFEPGCTFKVDEYGFFVYWKSEGREGD
VIELCQVSDIRAGGMPKDLKLFNQIVNKHGENVEEKSLTICSGTDYININMQHVICPDAA
TAKLWQQGLREVTHNNKMNNVCPRTNLMKHWMRLGFLVDPRGKVPVKVVARTFASGKTEK
LVYQILSDLGLPSGKNDAIERADFTFEKFYELYHKICPRNDIEELFRSITQGKSNTINMD
QFINFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQDEAAREAKTLTKDGLIRYLMSDE
NAPVFLDRLDIYMDMDQPLSHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRCVELD
CWDGKGEDEEPIITHGMAMCSDILFKDVIYALRDTAFVTSDYPVILSFENHCCRSQQYKL
AKYCDEILGDLLLKEPLPDYPLEPGAPLPPPSAMKRKILIKNKRLKPEVEKRELELFLQG
EFVAEDDVKEDASAVRKPEATEEVAAVATVAASQDGGEEVPAVQYTGSTTNVHPWLSSMV
NYAQPIKFQSFDYAENKNIHHNMSSFAETTGMNLLKQQAIDFVNYNKRQMSRIYPKGTRA
DSSNYMPQVFWNAGCQMVSLNFQTSDLPMQLNQGKFEYNNNCGYLLKPDFMRRADRSFDP
FADAPVDGVIAASCAVQVIAGQFLSDKKVGTYVEVDMYGLPSDTVRKEFRTRLVPANGLN
PVYNEEAFLFRKVVLPDLAVLRFGVYDENGKLLGQRILPLDGLQAGYRHISLRTDANFPM
SLPMLFCNIELKIYVPDGFEDFMDALSDPRAFMGAAKERSDNMKAMGIEESSAGGAADNS
KQAKKDEYLEPPIVFDPITVESLRQEKGFQKTAKKQQKELDSVKKKHAKERTGVQKQQNT
AIERLIKGKSKEEIKADPAIRKVIQEQNAQWSEMIERHKKEEWDLLKQQLDDQRDILRKL
MEATQASQMKQLEAKHEREIKTLNSLQAKISVETSKEVANDKTLKTKGEKDRRLREKKQN
NIKRFMDEKKTATIKQNREKEKLKVTHDKQLEELDNDVQKLIDMYKVDEEEYKMTSKMEF
YA
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcgtttcgagttcaactggcagattccggttccggaggctctgcaggccgga
tgtgtcttcgaccggtggtacgaggataaggataataacgaatttgaaccgggctgcaca
ttcaaagtggacgagtatgggttcttcgtctattggaagagtgaaggacgggaaggtgac
gtaatcgaactgtgccaagtcagtgacatccgagctggaggaatgccaaaggacctaaaa
cttttcaaccagatagtcaacaaacacggagagaacgtggaagagaaatccctcaccatt
tgctccggaacggactacattaacatcaatatgcagcacgtgatctgcccggatgcagca
acggccaagctgtggcaacaagggcttcgggaggttactcacaataacaagatgaacaac
gtctgccctcggacgaatctcatgaagcattggatgcgattgggattcctggtggatcca
cgtggaaaagttcccgtcaaagtcgttgccagaacatttgcctccggtaaaacggaaaag
ctagtctatcaaattttgtcagatttgggcctacccagcggcaagaacgatgccatcgaa
agggcggactttacgttcgagaagttctacgagttgtaccacaagatctgtcccaggaac
gatatcgaagaactgtttcgatcgattacccagggcaagagcaatactatcaacatggac
cagttcatcaacttcctcaacgaaaagcaacgtgatcctcggctgaacgagattctctat
ccgctgtacgacgagaagcgagcgctggaaatcatcaacacctacgagcaggacgaagcg
gctcgtgaagcaaaaaccctcaccaaagacggtctcattcggtatctcatgtcggacgag
aacgcaccagtattcctcgatcggttggacatctacatggacatggaccaaccgttgtct
cactactacatcaactcatctcacaatacgtacctgtcgggtcgccaattcggcggcaag
agttccgtcgagatgtaccgccaaacgttgctggccgggtgccgttgcgtcgagctggac
tgctgggacggcaagggtgaagacgaggaaccgatcatcacccacggaatggccatgtgt
tcagatattctgttcaaggacgtaatatacgcgcttcgtgatacggcgttcgtcacctcg
gattatcctgtgatcttatcgttcgaaaatcactgctgccgatcgcagcagtacaaacta
gctaaatactgtgatgaaatcctcggtgatctactgctgaaggagccactgcccgattat
cctctggaacccggtgctccgcttccgcctccatctgccatgaaacgcaagatcctcatc
aagaacaaacgactgaaacctgaggtggagaaacgtgagttggagctgttcctgcagggt
gaattcgtggcggaagatgacgtcaaggaggatgccagcgccgtgcgtaaaccggaggct
accgaagaggtcgcagctgtagcgacagtagcggcctctcaagatggcggtgaagaggtt
cctgcagtacagtacaccggttcaacgaccaacgtccacccctggctgtcgtcgatggtc
aactacgcccagccaatcaagttccaatcgtttgactacgccgagaacaagaatatccac
cacaatatgtcctcatttgccgagacgaccggaatgaatcttctgaaacaacaggccatc
gattttgtaaactacaataaaaggcagatgtcccgtatctacccgaaaggtacccgagcg
gattcgtccaactacatgccccaggtgttctggaatgctggttgccagatggtgtccctt
aacttccagacatccgatctaccaatgcagctgaatcagggtaaattcgagtacaacaac
aactgtggttatttgctgaaaccggatttcatgcggcgagctgatcgaagtttcgaccca
ttcgccgatgctccggtcgatggtgtgattgccgcctcttgcgctgtacaggtcattgcc
ggtcaattcttgtcggataagaaagtcggcacgtacgtcgaagtcgacatgtacggttta
ccctcggataccgtccgaaaagagttccgaacccgtttagttccggcgaacggtctcaat
ccggtctacaacgaagaagcattcctcttccgtaaggtggtgttgccggatctagccgtt
ctgcgattcggcgtctacgacgaaaacggtaaactgctcggacaacgaatcctaccgctg
gacggtcttcaggctgggtaccggcacatctccctccgaaccgatgccaatttcccgatg
tccctgcccatgttgttctgtaacattgaattgaaaatctacgttcccgatggatttgaa
gacttcatggatgccctgtccgatccacgtgctttcatgggagcagccaaggaacgatcg
gacaacatgaaggctatgggaatcgaagaatctagcgctggaggtgcagcggacaacagc
aaacaggcgaagaaggacgaatacttggaaccaccgatcgtattcgaccccattacggtg
gaatcgctccgacaggagaaaggcttccagaagacggccaagaagcagcagaaggaactg
gacagcgtcaagaagaagcacgccaaggaacgaacgggagtgcagaagcagcagaatact
gccattgaaagactgatcaagggaaagagcaaggaggaaatcaaggcggacccagcgatc
cggaaagtgatccaggagcaaaacgctcagtggagcgagatgatcgagcgccacaagaag
gaagagtgggatctgctcaagcaacagctggacgaccagcgagatatcctgcggaaactg
atggaagccacgcaggcttcgcagatgaaacagctggaggcgaaacacgaacgcgaaatc
aagacgctgaacagcctgcaggccaagatctcagtcgaaacctccaaggaggtggccaat
gataagaccctgaaaaccaagggcgagaaggatcgtcggttgcgtgagaagaagcaaaac
aacatcaaacggttcatggatgagaagaagacggccaccatcaagcagaaccgcgaaaag
gagaagctcaaggtgacacacgacaagcaactggaggagctggacaatgacgttcagaag
ctgatcgacatgtacaaggtcgacgaggaggagtacaagatgaccagcaagatggagttc
tacgcctga

DBGET integrated database retrieval system