KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL009583Help
Entry
AaeL_AAEL009583   CDS       T01053                                 

Definition
filamin, putative
Orthology
K04437  
filamin
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AaeL_AAEL009583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2294 aa AA seqDB search
MTNAAKDRCVRRRLPSSLSIALYSSDIVDCKLKLIMGLIWTLILHYSISLPMWEGDDSEN
QANGNNTTPKQRLMNWIHRLVPDLPINNFTNDWTSGKAIGALVDGVAPGLCPDWPMWDPK
DAVQNATEAMGLADDWLDVRQLIRPEEMVNPNIDEQSMMTYLSQYPNAKLKQGAPLRPKT
NPNRVRAYGPGIEPTGPVVGAPANFTVETFSAGKGTVDVAVVNPNGNSEKVDCRFNNDKN
LTYSCSYVPKIEGPHKVYVKFCGRDIPKSPYEVLVDSQAGDPSKVTASGPGIQPDGVTVN
KQTYFEISTKDAGKGVPEVIILDPANHKTSVAAKLRQLAQNHYRCEYTANQVGLHSVNVF
YNGQQIKNSPFGVRVAPVCDPKKVRASGRGLQPVGVRVNDEDCTFRIYTEGAGEGIPEVK
VFGPGGVIPEYSIRKVDGTTYEAQYIPLKEGRYKILVLFGGVEIPKSPFEVKVGPQKHTS
IVAYGPGLKSGMVGNPASFVVETNGETGNLGFSIAGPSQAEIECHDNGDGSALVKYHPTA
PGEYAVHILCDSEDIPKSPYIAHILPKVDDFHPELVKVSGPGIEKNGSVITNKPTEFTVD
ATKAGDAPLEVKINDVFANTIQHKFMKNSDGTKKVLYTAPTADPVTVEVNYGGVAIPGSP
FRVNVSTPLDPSKVQFFGPWLESGNRPNAATHFNVDARNAGNGLLEVNLIHEETKQKIPV
RIIDNDDNTYAVEVIPPLAGTYTTNLVYGGLKVPIAPKVTVNPAVDVSKIKVDGLEPTAP
LNSLQQFRVITNGIGKADLAVTITSPSGNRIKAHVIPTAEGFLVNFTPTQLGEYLLSVSF
GGTPITPQPFRLQCLVGSDSRKVQASGPGLIRGIINRPAEFMIDTRGAGQGGLGVTVEGP
CEAAINCRDNGDGTCNVAYLPTEIGDYTINITFNNDHIAGSPFQAIILPEPNLSRIRVSG
MGIQPHGVIMNAPTDFMVDMSKVGDDVDKSKLSCNIFDPRGNEIPSKLVPSDNSDIFRIM
YTPFEAGRHTIDLLYDNVPVPGSPFVVNVKSGCDPTRCRAYGPGLEHALTDQSATFTVET
RGAGAGGLSLAIEGPSEAKMSCTDNRDGSCDVEYVPTEPGEYDITIRFAEKHIPGSPFKV
IVNESTRPEKVKVYGPGIEHGQVCEGVPAEFYIDCGQAGPGAVAVKLTSSDGNPIKVHVE
DKGDGVYAVSYSPPKEGSVLTAKVRFADQDVSCSPFVMTVQPAPTDASPFKVYGDAATKK
NLPASLPAKFQIDAPKKGTTGATGKEDINVSIKGPDGKSLVPKMEQVEDGTYAVTFVPDE
CGPYNVSIKCGGKDVVGSPFLLQAIPTGEAEKVKLLEAIPTNQEYGKKNHVAVDAREAGT
GAVTCKIVSHSEAGDVDLEVIEKDGFFDIFYTLKDPGDYDLDIKFGGQHIPNGTFTIKAV
ENVEQQVTSTTSSTTKSSSATVSENQQIYQHQESYVEQVSSVSKSKLFHQQTACEEFLVS
PTSEIPSISAVTSHPLIYSFQVRERQLVNGKYENGLSNGHHAAITTNGNHVHSSSTTSVN
AVNNSSNSSSSVSKTSSAVQETCTTSSHTTSTSAVTSSGANRLRDFKLERLNLPQTGGAV
SDSKNLQEILTNPPGIHSRIKPFISTIPNDYFYSKYSLSNKNSHMVALANCFKISKVTLP
GVISDQDLRSLNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHTVSVKRLGKHIAN
SPFKVNVCEREVGDAKKVIVTGSALQEGKTHTENVFSVDTRNAGYGGLSLSIEGPSKAEI
QCTDKEDGTLNISYKPTEPGYYIVNLKFADHHVNGSPFTVKVSGEGTNRQREKIQRQRDA
VPVTEVGSQCKLTFKMPGITSFDLSATVTSPGGVTEDAEIQEIEDGLYAVHFVPKELGVH
TVSVKYKQIHIPGSPFQFTVGPLKDTGAHLVKAGGPGLEHGEQGVPCEFNVWTREAGGGT
LAISVEGPSKAEIEFKDRKDGSCDVSYVVSEPGDYRIGLKFNDRHIPDSPFKVYVSPAMG
EAHKLEIAQFPSGPVQADKPAQFMVRKNGAKGDLDAKVVAPSNNEDDCFIQLIDQDQYSV
RFYPRENGIHAIHVKFNGVHIPGSPYRIKVGKDDVDPAAVHASGKGLGDIKTGEKTDLII
DTCNAGAGTLAVTIDGPSKVAMDCTEVEEGYKVRYTPLLPGHYYMTIKYNQMHIVGSPFK
IKCTGDKLAEEGGQETSSVVVETVAKVSKGGNRTGVILPIFKSDASKVQSKGMGLKKAYL
GKQNQFTLNAGDAG
NT seq 6885 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgcggcgaaagatcgctgcgtccgtcgtcgtctgccgtcatcgctatcaata
gcgctatattcgtccgacatcgtggactgcaagctgaagctgatcatgggtctgatatgg
acgttgatcttgcactactcgatctcgctgccgatgtgggaaggcgacgacagcgagaat
caggccaacggcaacaacacaaccccgaagcagcgactcatgaactggattcaccggctg
gttccggacctgccgatcaacaacttcacaaatgattggaccagtggcaaggccattggt
gccctggtggacggagtggccccgggtctgtgtcccgattggcccatgtgggatcccaag
gatgccgtccagaatgcaaccgaagccatgggtctggccgatgattggctcgacgtgagg
cagctgattcggccggaggaaatggtcaacccgaacattgacgaacagtccatgatgacc
tacctctcacaatatccgaatgccaaactgaagcagggcgcacccttgcggcccaaaacc
aacccgaacagggttcgcgcgtacggtcctggcatcgaaccaaccggaccggttgttgga
gctcccgccaacttcaccgtggaaaccttctccgctggcaaaggaaccgtcgacgtggcc
gtcgtcaacccgaacggcaactccgagaaggtggactgtcgattcaacaacgacaagaac
ctcacctactcgtgttcgtacgtgccgaaaatcgagggtccgcacaaagtgtacgtcaag
ttctgcggccgggacatccccaagagtccctacgaggtgctcgtggacagtcaggccggt
gatccgtccaaggtgacagccagcgggcccggcatccagccggacggagtcaccgtgaac
aagcaaacgtacttcgaaatttcgaccaaggacgccggaaagggagtgcccgaagtgatt
atcctcgatccagctaaccacaagacgtcggtggctgcgaagcttcgtcaactcgctcag
aatcactaccgatgcgagtacaccgccaaccaggtgggtctgcactcggtgaatgtgttc
tacaatggacagcagatcaagaacagtccgttcggagttcgagtagctccagtttgtgat
cccaagaaggtcagagcgagtggtcggggacttcaaccggttggagttcgcgtgaatgat
gaagattgtaccttccgtatctacacggaaggtgctggagaaggcatcccggaagttaaa
gtattcggtccgggaggtgttatccccgagtacagcatccgtaaggttgacggtacaacc
tatgaagctcaatacattccattgaaggagggtcgctacaagattctggtgctttttggc
ggagtggagatccccaagtcacccttcgaagttaaggttggtccccaaaagcatacctca
attgtggcgtatggtcctggacttaaatccggaatggttggaaatccggcgagcttcgtg
gttgaaaccaacggcgaaaccggtaatctaggcttcagcattgctggtccctcgcaagca
gagattgaatgccatgacaatggggatggttcagctctagtcaaatatcatccaaccgcc
ccgggtgaatacgctgtacatatcttatgtgacagtgaagatatcccgaagagtccttat
atcgcacatattttgcccaaggtggatgacttccatcccgagctggtcaaggtatctggt
cccggaatagaaaagaacggaagcgtcattacgaacaaaccaactgaattcactgttgat
gccaccaaagccggagatgctccactggaggtgaagatcaacgacgtgttcgccaacacc
attcagcacaagttcatgaagaactcggatggcaccaagaaggtgttgtacaccgcacca
actgctgaccccgttactgtcgaggtgaactacggaggggtcgctatccctggatcgcca
ttccgagtaaacgtgtcgactccgttggatccatccaaggttcagttcttcggaccgtgg
ttggagtccggcaaccggcctaatgcagccactcacttcaacgtcgacgcaagaaacgct
ggcaacggactattggaagtcaatctcatccatgaagaaacgaagcagaagattccagtg
cgtatcatcgataacgacgacaacacctacgctgtggaagtgattcctccattggccgga
acctacaccacgaacctggtctatggaggactcaaagtcccaattgctccgaaagttacc
gttaaccccgcggtggacgtctccaagatcaaagttgatggcttagaaccaacggcaccg
ttgaacagtcttcaacagttccgagtgataacaaacggcatcggcaaggccgatcttgcc
gttacaatcactagcccttcggggaaccgcatcaaagcgcacgtcattcctacggccgaa
ggtttcctcgtcaatttcactcccacccagctcggagagtaccttctcagtgtaagtttt
ggcggtacgccgataactccccaacccttccgactgcagtgtctagtaggttccgattcg
cgtaaggttcaggccagcgggcctggcttgattagaggcatcatcaaccgaccggcggag
ttcatgatcgatacccgaggtgccggtcagggtgggctcggagtcaccgttgaaggtccc
tgtgaagctgccatcaactgcagggataatggcgacggaacgtgcaacgtagcctatcta
ccgacggagatcggagactacaccatcaacatcacgttcaacaacgaccacatcgccggg
tcacccttccaggcgatcatcctccctgaaccgaacctgagccgcatccgggtgtccgga
atgggaatccaaccgcatggtgtcatcatgaacgctccgaccgacttcatggtcgatatg
agcaaggttggggacgacgtggacaagagcaagctctcctgtaacatcttcgatccgcgt
ggcaacgagatcccgagtaagctggtcccgagcgataacagcgacatcttccggatcatg
tacaccccgttcgaagccggtcgtcataccatcgaccttctctatgataatgtgccagtt
ccgggatcgccgttcgtcgtcaatgtaaaatccggctgtgatccgactcgttgtcgcgct
tacggtccaggtcttgaacacgctctgactgatcagtcggccacgttcacggtggagact
cgaggtgccggtgctggaggtctgtcgcttgccatcgaaggaccttccgaggccaagatg
agttgcaccgacaaccgtgacggatcgtgcgacgtcgagtacgtgccaaccgagccggga
gaatacgatattacaatccgtttcgctgagaagcacattcccggatcaccgttcaaggtt
atcgtcaatgagtcgacccgtccggagaaggtcaaggtctacggtcctggaatcgagcat
gggcaagtttgcgaaggagtcccggcagagttctacatcgattgcggacaggctggacct
ggtgcggtcgctgtcaagctgacctcgtccgatggaaacccaataaaggtacacgttgag
gacaagggtgacggcgtctacgctgtttcctacagtcctcccaaagaaggatcggtcctc
acggctaaggttcgcttcgctgatcaggatgttagctgcagtccattcgttatgaccgtc
caacccgctccaacggacgcatctcccttcaaagtctacggagatgccgccaccaagaag
aatctccccgcatcgctgccggccaagttccaaatcgacgctccgaaaaagggcaccacc
ggagcaacgggcaaggaggatatcaacgttagtattaagggtcccgacggaaagtcgctg
gtgcccaagatggaacaggtcgaggatggtacgtacgctgtgacgttcgtgccggacgag
tgcggaccctacaatgtcagtattaagtgcggcggaaaggacgtggtaggatcgcctttc
ctgctgcaggctatccccactggggaggcggaaaaagtaaaactcttggaggctattcca
actaatcaagagtacggcaagaagaatcatgtggccgtcgatgcgcgagaggctggaacc
ggcgcggtcacttgcaaaattgtgtcccattctgaagctggggacgtcgacctggaggtg
atcgaaaaggacggcttcttcgacatcttctacaccctcaaggacccgggcgactacgac
ctggacatcaaattcggcggccagcacatccccaatggcacgttcaccatcaaggccgtt
gagaacgtcgagcaacaggtgacgagcaccaccagcagcacaaccaaatcctcatcggca
accgtttcggagaatcagcaaatctatcagcatcaggaatcctacgtagagcaggtctcg
tccgtgtccaaatccaaactattccaccagcaaaccgcgtgcgaggagttccttgtaagt
ccgacctctgaaataccttcgatctccgccgtaacgtctcaccctctcatttactcgttt
caggtccgcgaacgccaactagtcaacggcaagtacgaaaacggtttgagcaacggtcac
cacgctgccattacaaccaacggtaaccacgtgcactcgtcttcgacgacctcggtgaac
gccgttaacaactccagcaatagtagcagtagcgttagcaaaactagttcggcagtgcag
gaaacctgtaccaccagtagtcacaccactagcactagcgccgttaccagcagtggtgcc
aaccgactgcgagatttcaaactcgaacggttgaacctgccgcagaccgggggtgcagtg
agcgattcaaaaaatttacaagaaattttaacaaatccgccaggcattcattcgcggatc
aagccttttatctctacgattccgaacgactatttctattccaaatactcgctttcgaat
aaaaatagtcacatggttgcattggctaattgttttaaaatcagtaaggtcactctgccc
ggcgttatctccgatcaggatctccgttcgctcaacgcttccatccaggctccatcgggt
ctggaggagccgtgcttcttgaagcgcatgcccaccggcaatatcggcatctcgtttaca
cctcgtgaaatcggcgaacacaccgtttcggtcaaacgactcggaaagcacatcgccaac
tccccgttcaaggtgaatgtatgcgaacgtgaagtgggcgatgccaagaaggtcatcgtc
accggcagtgcactccaagagggcaaaacccataccgaaaacgtcttctccgtggacacc
cgcaacgcaggctacggtggtctatcactgtccattgaaggacctagcaaggccgaaatc
caatgcactgacaaagaggacggcaccttgaacatctcctacaaaccaaccgaaccgggc
tactacatcgttaacctgaaatttgccgatcatcacgtcaatggatcgcccttcaccgtt
aaggtatccggtgagggaaccaaccgacaacgcgagaagatccaacgccaacgcgacgcc
gtcccggtcaccgaagtcggcagccaatgtaagcttacgttcaaaatgccaggaattacc
tcattcgacctgtccgcaaccgtaacctcgcccggaggagtcaccgaggacgccgaaatc
caagaaatcgaagacggcctctacgcggtgcacttcgtgccgaaagaactcggcgtacac
accgtttccgtcaagtacaagcagatacatattcctggatctccattccagttcacggtc
ggtccactgaaggacaccggtgcccatttggtgaaggccggtggaccaggtctggagcac
ggtgaacagggagtgccatgcgagttcaacgtgtggacccgcgaggccggcggtggcacc
ctggccatctccgtcgagggtcccagcaaggccgaaatcgagttcaaggaccgcaaggac
ggctcgtgcgacgtgtcgtacgtcgtcagcgaaccaggtgactaccgcattggactgaag
ttcaacgaccgccatattccggattcgccattcaaggtttacgtatcgccggccatgggt
gaagcccacaagttggagattgcccagttcccaagtggaccggtgcaagctgacaagcct
gctcagttcatggtccgaaagaatggtgccaagggtgacctagacgccaaggtcgttgcc
ccatcgaacaacgaggatgattgcttcatccagctgatcgatcaggaccaatactcggtg
cgtttctacccccgcgagaacggaatccacgccatccacgtcaaattcaacggagtgcat
atccccggatcgccgtaccgtatcaaggttggcaaggatgacgtcgacccggctgcagtg
cacgcctccggtaaaggcctaggcgacatcaagaccggcgagaaaaccgacctcatcatc
gacacctgcaacgctggcgctggaaccctggccgttaccattgacggaccctccaaggta
gctatggactgcaccgaggtcgaggaaggctacaaagtacgatacactccactgctaccg
ggacactactacatgaccatcaagtacaaccagatgcatatcgtcggatcgccgttcaag
atcaagtgtacaggtgataaactcgcggaggaaggtggccaggaaacgtcctcggtcgta
gtggaaacggtggccaaggtgtcgaagggaggcaaccgaaccggagtcattctgcccatc
ttcaaatcggacgccagcaaagtgcaatccaagggcatgggactcaagaaggcgtacctc
ggcaaacagaaccagttcacgctgaatgccggagatgcaggttag

DBGET integrated database retrieval system