KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL009880Help
Entry
AaeL_AAEL009880   CDS       T01053                                 

Definition
serine/threonine protein kinase
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AaeL_AAEL009880
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: Other group
  Aur family [Table]
   AaeL_AAEL009880
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AaeL_AAEL009880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 405 aa AA seqDB search
MSQLNKENRKLFLQPPVNGKLQASGSATTTGTFTSRSLKPINPSGSGAASESKPQNVFKL
PPPPSAAVKKEQPKTFTKPQISVPQSKEDPQFKVPTAPSVTGKPRSEGQKPITGSSTATQ
GQQQQQSATSTGAPNKEKKSWTLSNFDIGRPLGRGKFGNVYLAREKETKYVIALKVLFKK
EVHAQGIEHQVRREIEIQSHLRHPNILRMYGYFHDETRIYLILEYAPGGTLFSKLQTQPG
NKFPEEQCAVYVNMLVSALIYLHERNVIHRDIKPENLLLGHGGELKIADFGWSVHEPTST
RTTLCGTLDYLSPEMVQGHPHTKNVDLWSLGVLAYELLVGRAPFHATSYDETYNKIMKVR
YVIPPEMSRPAAHLISRLLVRQPEQRIPLEQVANHPWIKLHVGSK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagctaaataaggaaaatagaaaactattcctgcaaccgccagtcaacggaaaa
ctacaggcaagtggcagtgcaacaacaaccggtacttttacatcccggtcattgaaaccg
ataaatccgtccggtagtggcgcggcatccgagtccaagccacaaaatgtgttcaagcta
ccacctccgccaagtgctgccgttaaaaaggaacaaccgaaaaccttcacaaagccgcag
attagtgtcccacagtcaaaggaagatccacagttcaaagtccccactgcaccatcagtg
acaggtaaaccaagatcagaagggcagaaacctatcaccggttcttcaacagcaacgcag
ggacagcagcaacagcaatcggccacctcaaccggggcaccgaacaaagagaaaaagagc
tggaccctgagcaacttcgatatagggcgaccgttgggtcggggcaagttcggaaacgtc
tatctggctcgcgagaaggaaaccaaatatgttatcgccctgaaggtcttgttcaagaag
gaagtccacgcccagggaatcgaacatcaggtacgccgtgaaattgagatccaatcccat
ctgagacacccgaacatcctccggatgtacggctatttccacgatgaaactagaatctat
ctaattctggaatacgcacccggtggaacactgttcagcaagctgcaaacgcagccaggg
aacaaattcccggaagaacagtgtgcagtctacgtcaatatgctggtgtcggctttgatc
tatctccacgagcggaacgtcatccacagggacatcaagccggagaacctcctgttgggc
cacggaggagagctgaaaatcgcggactttggatggtctgttcacgagcctacctctact
cggaccacactttgcggaacgttggactacctttcaccggaaatggtccaggggcatccc
cacacgaaaaatgtcgatctctggagtttgggagtgctagcgtacgagctgctggtgggg
cgagcacctttccacgctaccagctatgatgaaacctacaataagattatgaaggtacgc
tacgtgattcctccggaaatgtcccggccagcagctcatctgatttcgcggctgctggtg
agacaaccggagcagcgcataccactggaacaggtggccaaccatccctggatcaagctg
cacgtcggctcgaagtag

DBGET integrated database retrieval system