KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010008Help
Entry
AaeL_AAEL010008   CDS       T01053                                 

Definition
crotonobetainyl-CoA-hydratase, putative
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AaeL_AAEL010008
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AaeL_AAEL010008
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AaeL_AAEL010008
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AaeL_AAEL010008
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     AaeL_AAEL010008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 371 aa AA seqDB search
MLRSVQRNVPLIARGMSSGAERTVICEEVGKNAGLITLNRPKALNAINLDMVRQIYGAMK
NWQDKSLVIVKGAGEKSFCAGGDVRAVVENGPIDSSRNFFREEYRLNALISAYKPDYVAI
VDGITMGGGVGLSVHGKYRVATERTMFAMPETAIGLFPDVGGGYFLPRLQGKLGLYLGLT
GFRLKGKDVTKAGIATHYVESKDLEALEKELIATSNSSEVAEVLNKFNVKDASDFVLAKN
MEQINKCFSAPTVEAIVTNLEKDGSEWASSTLKTLSKMSPTSMKVTKKQLDLGLNCDLRS
CLKMEFRMAVHSVIKSDFKEGVRAMLIDRDQSPKWDPARLGDVTEQQVDRFFGPLPDGDE
LLFDDEMKANL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgatccgtccaaagaaacgtaccgttgatcgcccgtggcatgtcctccggcgcg
gaacggaccgtcatctgcgaagaggtcggtaagaatgccggattgataacgttgaaccgc
ccgaaggcactgaacgccatcaacttggacatggttcggcagatctacggagcgatgaag
aactggcaggacaaaagtctggtcatcgtgaaaggcgcgggggagaagtcattctgtgcc
gggggcgatgtccgagcagtggtcgagaatggaccgattgactcgtcgaggaactttttc
cgggaggagtaccgccttaatgcactgatttcggcctataaaccggactacgtggcaatc
gtggacggaattacgatgggtggaggcgtcgggctgtccgttcacggaaagtatcgagtg
gcaaccgagcggaccatgtttgccatgcccgagacggccatcggtttgttcccggacgtc
ggaggtggatactttttgccacgattgcaaggcaaactaggcctctatctgggattgacc
ggtttcaggctaaaggggaaagatgtcacgaaagccggcatcgctacccattacgtggag
agcaaagatctcgaagccctggagaaggagctgatcgccaccagtaatagctcggaagtt
gctgaagttctgaacaagttcaacgttaaagacgcatccgacttcgttctggccaagaac
atggaacagatcaacaagtgcttcagcgcaccaacggttgaagccattgtgaccaacctg
gaaaaggatggcagcgaatgggccagcagcacgctgaaaaccctctccaagatgtcgccc
acgtcaatgaaggtcacgaagaaacagctggaccttggccttaactgtgacctgcgtagc
tgtctgaaaatggaattccgaatggcagttcatagcgttatcaaaagcgacttcaaggaa
ggagttcgggcaatgctgatcgaccgcgatcaaagccccaagtgggatccggccaggttg
ggcgatgtaaccgaacagcaggtggatcgtttctttgggccgcttcccgatggcgatgag
ctgctgtttgacgatgagatgaaagcgaacctgtga

DBGET integrated database retrieval system