KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010065Help
Entry
AaeL_AAEL010065   CDS       T01053                                 

Definition
protein disulfide-isomerase A6 precursor
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aag04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 437 aa AA seqDB search
MGTSSIWMVVTLLAGLASSGWALYSSSDDVVELTANNFDRMVVKSDEVWVVEFYASYCGH
CRNLVPEYKKAATALKGVIKVGGINCEEEQSLCGQHGVRGYPTIKIFGANKRSPVDYNGQ
RTAKDIAEAALAEAKKKIKNVLSGGSSGSSSDSGSSDSKDVVELTDSNFDKLVLNSDDIW
LVEFFAPWCGHCKNLAPHWAKAATELKGKVKLGALDATVHTIKAQQFGIQGYPTIKFFAG
GPKDRDSAQEYDGGRTASDIVNWALEKHSENIPAPEIVQLTSEEVTKATCEEKPLCVVSV
LPHILDCDAACRNNYLAILAKMGEKYKKKQWGWLWSEGGAQPEIESTLDIGGFGYPAMAV
VNVKKMKYSLLRGSFSEEGINEFLRDLSYGRGHTAPVKGAALPKIHNVEPWDGKDGQLPE
EEDIDLSDVDLDEKDEL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgtcatcgatctggatggtggtgactttgttggccggtctggccagttccggt
tgggctttgtactcttcgtcggatgacgtcgtcgagctgacggctaacaatttcgaccgg
atggtggtgaaaagcgacgaagtttgggtggtggagttctacgcttcatactgcggccac
tgccggaacctggtcccggagtacaagaaggctgccaccgctctgaagggagtcatcaag
gttggtggaattaactgtgaggaagagcagagcctgtgcggtcagcatggagttcgagga
tatcctacgattaagatcttcggagccaataaacgatcgccggtagattacaacgggcag
cgtactgccaaggacattgccgaggccgcacttgccgaagctaagaagaaaatcaagaat
gtcctgagtggaggttccagtggatcgtcgtccgatagcggtagctccgattcgaaggat
gttgtcgagctgacagattccaacttcgataagcttgtcctgaacagtgacgacatttgg
ttggttgagttcttcgctccatggtgtggacattgtaagaatctggctcctcactgggct
aaggctgccacggaattgaagggtaaggtcaagcttggagccctggacgctaccgtgcac
acgatcaaggctcaacaattcggcattcagggatacccaaccatcaaattcttcgcgggt
ggtccaaaggatcgtgactccgctcaggaatacgacggcggccgcactgcttcggatatc
gtaaactgggccttggaaaagcacagcgaaaacattcctgctccggaaattgttcagctc
acgtcggaggaagttaccaaagcaacttgcgaagaaaagcctctgtgcgttgtgtcggtc
cttccgcacatcttagactgtgatgcagcctgccggaacaactaccttgccatcctggcc
aagatgggcgaaaagtacaagaaaaagcagtggggctggctgtggtccgaaggcggagcc
caaccggaaattgagtccaccttggacattggaggctttggctatccggcgatggccgtc
gtcaatgtcaagaagatgaagtactctctgctgcgtggatccttctcggaggaaggcatc
aacgagttcttgcgagatttgtcctacggtcgggggcacacggctccggtcaagggtgcc
gcactgcccaagattcacaacgtcgagccctgggacggcaaggacgggcagcttccggaa
gaagaggacatcgatctgtccgatgtggatctggacgagaaggatgagctctaa

DBGET integrated database retrieval system