KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010215Help
Entry
AaeL_AAEL010215   CDS       T01053                                 

Definition
filamin, putative
Orthology
K04437  
filamin
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AaeL_AAEL010215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 1752 aa AA seqDB search
SPWNINIMSSPGLTALGESTRLVPANVPAVFEVLPPPGASIRGSDCVATVLSPSKSKVNA
RVTHEAANGAVRIEFVPNEVGTHIIEASIGGTTLVGGPLIAKVYDSSLIQVTDVNGGVVG
QPCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKPHLIDIKFNGET
VMGCPFVCSVADTSRVLLNLSNLELIPVNRPASFHITVSGGGAAELAVSVRGPQGELPVR
VTGDIHAGFTAEFTPNNVGAHTINVEYNGYPVQGTPFVAKSYDATKVGVGSVSKGTVGRP
VQFTVDAGDAGEGNLEITISAKGHNIPTQVHPQGNAKFAVSFVPAEPCEHIINVSFNKML
VPGCPITVIINGGTTGPQVSLGGPGPLHLPNSLIINHAGGRLEDIEVNVEGPSGHSVPAQ
VLQTADGVFKAEFVPRVVGEHRVSVSVEGQPTVGSPYSAKVYDVTAIKVKNVNNGTVGKP
VVFLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAQNHTVELRFNGQDVP
GSPFTCKVSPAARIVTSDLMDKVSVGHVFDFLVESDISPVVEVLGPARRAVRADVIPVSG
AYRVKFEPIEVGDHSVEVRLPGSGHVEGSPFLLKAYSAEKVVVTDIRPGVVGKSVSFGIN
ASQAGAGNLEIIVAVGGKNVPNFVQSEGNARFKVNFKPTEAATHSLSVRFNGYPVPGSPF
ACHVTHAPVSLSKAIATGECLRQAPVKCENIFELEGFDGVDPQVLITSPSGDTVSSRVSF
RDDIHFVSFVPTSVGRHLISVTANDQHINGSPFSCNVFDVSRVAISGLDHHNTLASLGVP
LTFSVDAAGAGEGTLELVVSTATSTVKAEVTACARGLYDVTFVPQTCEPHFVNITFNDLP
VDGSPFRCEVQQNTQNVQVGNSTFIELVGEDQTVEIYDPENKMVPFTLSRKAAEFKATKI
GSYIVRYVDQETRSFIAARTINVFDPSMVKIVEVGEAYCHKPASLAVSILDAGQGTLTSV
VRCGGLEVPHSIRGPTKNGTWEIVYHPTRVAPHKIMILYNQVPIANKPIEINVLAPAMSK
EITVNGLGLYQARVSKTTSFAIDTVGHPAREFDVVVSGPGGQALPVRCYQTKGGHLQAEF
TVQKVGQCLIDVLHQSKPLPGSPYTCESYDPSKIHLQKVPKMNLCTNSPITWNVESEAAG
VAEIEVTVLSPTGQNVPVQLTQQEDYVHQVEFLPLTAGHYKATVMYGGESVPGSPITFAV
QAVGSKTDSHASGNGLEVAHRGKETSFVVFCPSMPNVQIERCDEQAERIEPKIKNLGNNE
WKIFYTILTVGEYEIRASCTNRGPLPGSPWTISCLDPAKVTPIGGWGSLLDNNGKLLLPA
KIAFDTSMAGPGELTCYVDSTEVNVEKQSNGRCILYLSDEELSKGEHSFDLTWSGLPISQ
SPGYVFVTGNSSAADKVVLTGRGLTSAQVGEISHFTIDASEALSGKPEVHMEFEDGENLP
VTLLQPRPNELIWLASYNPHKSTGGPLSLSVEWNGRLIKGCPLTISVGPAVDAAKVLCSG
EGLRNGVVGRDIKSWIDTRRAGPGELTAHCAGPRKVAYCELYDHGDATFTLNVKPQEPGR
HTLTIKYGGQHVPGSPFTLRVAGAPDASKVRVYGPGIEHGVLATFQSRFIVDTRGAGAGQ
LTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGELVPGSPFPVLIFD
TQEELKRFLHGN
NT seq 5259 nt NT seq  +upstreamnt  +downstreamnt
tcaccgtggaatatcaacataatgtcctcaccggggctgacggctctcggtgaatccacc
cggctggttccggccaatgtgccggcggtttttgaggttctgccgcctcctggagcttcg
atccgaggcagtgactgcgtagcgaccgtgctttcgcccagcaagagcaaagtcaacgcg
cgagtcacccacgaggcggccaacggtgccgtgaggattgagtttgtccccaatgaagtc
ggaacgcacatcatcgaggcctcaattggcggcaccaccctggtcggaggaccactgatt
gccaaggtgtacgactcgagtctgattcaagttacggatgttaacggtggagtggtgggt
cagccatgccagttcagggtagatgccagtgcggccggagaaggccaactggaaatttcg
attaatgaaggcgaagtcccaaatcatgtacaagtcgttggaggtggtagatgtctggta
tcgtttactccggagcaagcgaagcctcatttgattgatatcaaattcaacggagaaact
gtcatgggttgtccgtttgtgtgctcagtagccgataccagtcgagttctgctgaaccta
tcgaacttggaattgattccggtgaacaggccagcttcattccacatcactgtcagtggt
ggaggagccgcagagctggctgtcagtgtacgtggtccacagggagagctacccgtaaga
gtgaccggtgacatccacgccggattcacggcagaattcactccgaacaatgtcggagct
cacacaatcaacgtcgagtacaacggttatccagtgcagggaactcccttcgttgccaag
tcttatgacgcgaccaaggtcggagtcggatctgtatccaaaggaaccgttggaagaccc
gtacagttcactgtagatgccggagacgccggcgaaggaaatttggagattactatctct
gctaaaggccataatatacccacccaggtgcatccgcaaggaaacgcgaaattcgccgtg
tcgttcgtccccgccgagccctgtgagcacatcatcaacgtgtcgttcaacaaaatgctc
gttcccggttgccccatcacggtgatcatcaacgggggaacgacggggccgcaggtgtcc
ctcggtggacccggcccgctgcatttgccgaattcgctcatcatcaaccacgccggaggc
cgactggaggacatcgaagtcaacgtcgaaggaccgtcgggacactcggtgccagcgcag
gttctgcagacggccgacggcgtattcaaggcggagtttgtacctcgggtcgtcggcgaa
caccgggtcagcgtttccgtggagggtcagccgaccgtgggcagtccctactcggcaaag
gtttacgatgttacggcgatcaaggtcaagaacgtcaacaatgggacggtgggaaagccg
gtcgtcttcttggttgaaacgtcccaagcagggccaggaaatctggaggtaacggtgaac
ggtggacgagtgcctacttcggctcaagctcaaggtcagcatacgtacgcgatcagtttc
actcctcgggaagcccagaaccacaccgtggagttacgcttcaatgggcaggatgtaccg
ggaagtcctttcacgtgcaaggtctctccagcagcgcgcatcgtcaccagcgatctgatg
gataaagtaagcgtggggcatgtgtttgacttccttgtggagtcggatatatctccagtt
gtggaagttcttggtccagctcgacgtgcagttcgtgccgatgtgattccagtttccggt
gcgtatcgggtaaaatttgaaccgatcgaggttggtgatcattcggttgaggttcgcttg
cctggcagtggtcatgtggaaggaagtccgttcctgttgaaggcctattctgctgaaaaa
gtggtcgtgaccgatatcagacctggagtcgttggaaagagcgttagtttcgggatcaat
gcaagccaagccggagctggaaatttagagatcattgtcgctgtaggtggaaaaaatgta
ccgaactttgtccaatctgagggtaacgccaggttcaaagttaacttcaagcctaccgaa
gctgcaacgcattcattgtcggttagattcaacggttatccagttccagggtcaccgttt
gcttgccatgttacacatgctcctgtatcgctctctaaggcaatagctaccggcgaatgt
ctgagacaagctccggtcaaatgcgagaacatcttcgagctcgaaggattcgatggcgta
gatcctcaagtgttgataacttccccgtctggagataccgtttccagtagagtgtcattc
agagacgacatccactttgtgtcattcgtacctacttcagttggtagacatttgatcagt
gtaactgccaatgatcaacacattaatggatcgccattctcttgcaatgtattcgacgtt
tcgcgtgtggcaatcagtggactcgatcatcataacactttggcttctttgggagtaccg
cttaccttcagtgttgatgctgctggagcaggcgaaggaactctcgaattggttgtatca
actgcaactagcaccgttaaagctgaagtcactgcatgcgcaaggggattgtacgacgta
acatttgtaccgcaaacctgtgaacctcattttgtcaacattacattcaacgatcttccg
gtagacggaagtcctttccgctgcgaggttcagcaaaatacgcaaaatgtgcaggttgga
aacagcacctttatcgagttggttggtgaagatcaaactgtggaaatctacgacccagag
aacaagatggtaccgtttactttgtccagaaaggctgccgagttcaaagccaccaaaatc
ggaagctacatcgttcgttacgttgatcaggaaacccgttcattcatcgccgcaaggaca
attaacgtatttgatccttcgatggtaaagatcgtcgaggtcggggaagcttactgccat
aaaccagcatccctggcggtatcgatcttggatgctggtcaaggaacgcttacttccgtg
gttcggtgtggtggcttagaggtaccgcattcgattcgaggaccgaccaagaacggtact
tgggagattgtgtaccatcctacaagagttgctccacacaagattatgatcctttacaat
caggtaccgatcgctaataagccgatcgaaataaacgtcttggcaccagctatgagcaag
gagatcactgtcaacggcttgggactgtaccaggctcgtgtctccaagaccacctcgttt
gccatcgacaccgttggtcatccggcacgggagtttgacgtggtcgtttccggcccggga
ggtcaagctctgccggtgcgctgctaccagaccaagggaggccatctgcaggcggaattc
accgtacagaaggttgggcaatgcttgattgacgttctccatcaatcgaaacccttgcca
ggaagtccgtacacctgcgagtcgtacgatccatctaagatccacctgcagaaagtgccg
aagatgaacctttgcacgaactcgcccataacctggaatgtggaatccgaggcggccggc
gttgccgaaatcgaagttacggtcctgtcccccaccggacagaatgtgccggtccagttg
acccaacaggaagactacgttcatcaggttgaattcttgccactgactgccggtcactac
aaagccactgtcatgtacggaggtgaaagtgtaccgggttcaccgattacgttcgctgtt
caagccgttggaagcaaaacggatagccatgcgtccggtaatgggttggaagttgcccac
cgtggcaaggaaacctcctttgtggttttctgcccgtctatgcccaatgtgcagatcgaa
cgatgtgacgagcaagcggaaaggatagaacctaagattaagaacttgggtaacaacgaa
tggaagatattctatactattctgacggttggagagtacgagatcagagcgagttgtacc
aaccgaggtcccttgccagggtcgccgtggaccatttcttgcctggatccggctaaggtt
acaccaatcggaggctggggaagtctgctggataacaacggaaagctactgttaccagca
aagattgccttcgataccagcatggccggtccaggtgaactgacctgttacgtagacagt
acagaagttaacgttgaaaagcaaagcaatggacgatgcattctctatttgtcggacgaa
gaactatctaagggagagcatagctttgatttgacctggtctggactgcccatctctcag
agtcccggctacgtattcgtcacaggaaactcatctgccgcggataaagtggtgctcacg
ggaagaggtcttacatcggctcaagtgggtgaaatatctcatttcactatcgatgcttcg
gaggcattatctggcaaaccagaagtgcacatggaattcgaggatggagaaaatctacca
gtaactttgctacagccaaggccaaacgaactgatctggcttgcgtcatacaatcctcac
aaatcaaccggaggacctttgagcctctccgtcgaatggaacggtcgtctcatcaaggga
tgtcctttgactatctcagttggaccggcagtagatgccgctaaagttctctgttctggt
gaaggtcttcgaaatggtgtggttggtagagacattaaatcctggattgacactaggcga
gcaggaccaggagagctgaccgctcactgtgctggtccacggaaagtcgcttactgtgag
ctatacgatcatggagatgctactttcacactgaacgtgaaacctcaagagccgggtcgc
catacactaacgatcaaatatggaggtcagcacgttcctggctcgccattcactcttcga
gtagcaggcgctcccgacgccagtaaggtccgcgtctacggtccaggaatcgagcatggc
gttctggcgacgttccagtcgagatttattgttgacacgcgaggtgctggtgcaggtcaa
ttgacggttcgtgtacgaggacccaagggtgccttcagagtcgagatgcagcgcgaaagc
cagaaagatagaactattctatgcaagtatgatccaacggagccaggcgactatcgggtg
gaggtcaagtgggccggcgaattggtgccagggtcacctttcccagtgctgatcttcgat
acgcaggaggagctcaaacgattcttacacggcaattaa

DBGET integrated database retrieval system