KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010470Help
Entry
AaeL_AAEL010470   CDS       T01053                                 

Definition
calcineurin b subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    AaeL_AAEL010470
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AaeL_AAEL010470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNETSLPMELCSNFDADEIRRLGKRFKKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLKFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIVFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaaacgtccttgcccatggaattatgctcaaatttcgacgccgatgagatc
cgtcgcttgggcaagcgcttcaagaagcttgatttggacaactcaggcgcgttgagcatc
gacgagttcatgtccctgccggagctgcagcagaatccactggtgcaacgcgtcatagac
atcttcgacgcggacggaaacggcgaagtcgacttcaaggagttcatccagggtgtctcg
cagttcagtgtcaagggcgataagctgtcgaagctgaagtttgccttccgaatatacgac
atggataatgacggcttcatctccaatggggaattgtttcaggtgctaaaaatgatggtc
ggaaacaacctgaaagacacccagttgcagcagatagtagacaagacgattgtgttcgcc
gacaaggacgaggatggtaaaatctcgttcgacgagttctgttccgtggtcggcaatacc
gatatccacaaaaagatggtcgtcgacgtctaa

DBGET integrated database retrieval system