KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010496Help
Entry
AaeL_AAEL010496   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 408 aa AA seqDB search
MSTSWRIWSPAEYTIPELAYEDILAQGCGQGRRTNIPWNKLVNRGTAASVFWVMKVKWGK
ENFPSVDVNTDEEPMLFKAQLYALTGVQPERQKVLCKGISLKDDEWNVPIKNGTTLLLLG
TKEEVPQEPVEKPKFIEDMNESELATALELPAGLTNLGNTCYMNATLQCLKSVRELRDSL
KQFKDDSSASSGLAGLASPGAITQSMRNLFDDMEKSDTVTPVLFLQRLHIAFPNFAQTGE
NGTYRQQDANECWSELLKMLQQKLPATKGDKDQLVKHNSFIDQWFGGSFDVEMKCTEAED
EPVSKSKENFLQLSCFISTEVKYMHSGIRLRLKEQLTKQSPSLGRDAVYTKTKISAFETV
SRSTSRPLCLPCLDSEMCHHNSIVKDHRVSYRTQNSATITLNVINTNQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacttcatggagaatctggagtccagccgaatataccattccggagctggcctat
gaggacatattggcgcaaggctgcgggcaaggcagaagaacaaacatcccttggaacaaa
ctggtgaaccgtggcacggcagcttcggtgttttgggtaatgaaagttaaatggggcaag
gagaacttccctagtgtggacgtgaacaccgatgaagaacctatgctgttcaaggcccag
ctgtacgctctgacgggtgtccaaccggagcgccaaaaagtgctctgcaagggaatcagc
ttgaaggacgacgagtggaacgtaccgattaagaatggaaccactctactcttactgggc
acgaaggaggaagttccgcaggaacccgtcgaaaaacccaaattcatcgaagacatgaac
gaaagtgaattggccactgctcttgaactccccgccggtttgactaatctgggcaacacc
tgctacatgaacgcgactctacagtgtttgaaatcggtccgggaattgcgcgattcgttg
aagcaattcaaggacgattcttcggcatcgtccggattggctgggctggcctcccccgga
gcaatcacacagtccatgcgtaatctgttcgacgatatggagaaaagcgacactgtcacg
ccggtgctgttccttcagcggttgcacattgcctttcccaattttgcacaaaccggtgaa
aacggaacgtaccgtcagcaggacgccaacgaatgctggtccgagctgttgaagatgtta
caacagaagttacccgctactaaaggagacaaagatcagctggtgaagcataactccttc
attgaccaatggttcggaggttctttcgatgtggaaatgaagtgcaccgaagcggaagat
gaaccagttagtaaatcgaaggaaaatttccttcaactaagttgtttcatctccactgaa
gtcaagtacatgcattcgggtattagattgaggttgaaagaacagctaacgaaacagtcg
ccttctctgggccgggacgcggtttacaccaaaacgaagattagtgcctttgaaaccgtg
agtaggagcacaagccggccattgtgtctgccatgtttggattccgagatgtgtcaccat
aactcgatagtaaaggaccatcgagttagttacagaacacaaaacagtgcaacaataacg
ctcaatgttataaataccaaccagtaa

DBGET integrated database retrieval system