KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010526Help
Entry
AaeL_AAEL010526   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL010526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1925 aa AA seqDB search
MFTVLFAATPDDMWTPFKHLFNSIESFLAASGSGASLDALLRKHKQNFTTLLRNPPKNGK
SREAIRVGITEGITLPEFGHTILSKDLVDESVIISDMYDLNEYIALELLCTAQQQMPNHP
GLPRGLVAVLLYYDGRKSLVASLKELFQARSGVSWCTDAPHEITQLITAYTDGLVADGVL
DKIVDLLGELDVTKELDVLTTNRALGPPKHHRQVLDLFEEIRVLLATCLFNWAAQCGLPR
GTTVKLIRYLAKYKSTVSSGGIDNVTLALQMALMYGLDMSVIQRREDGEEVVKRLPMVKD
PEFIETVMDAISSSWECEGLRSVSLFTFGLAIATLRLAPQNLYSNTAKIIDQDELLVDAA
IQGRVFDFIHYTLLENEVIFRTEFYYRRMHVLFTDFIELMHSKVTELRARADETARTVQA
FQQQGLDPPANLCRNFEALLLSVGKLYQNDQMRLNLSLEYWGPMEVAANYQRASSRSVCL
FKFIRLAGELLPPILFIPYLKMLAGLSSCPQSARNAFNLLKQGGGASGSMATISWDHFFN
SLFRYYQNLRQEQNPGSETVYRNRALSRNINPQEIAGLQAVLQVIRAVATHDEVARVALC
EHPNWAPLHVLLGLISCSVPISLKAELVQTLAALGKSKETALQLWNNLEASQVITTIPTT
NPTEKWQIAEKCLRLLNAFVQRYTPTPVDFPSPTQNREENSPPGFHILLQINTKSDFLRL
LLHIIDEACTLFDSYTPFPGRKHLETTCLFALQILERALETQEDFFNAHFSANCSILLAG
ANKLLLGMNPRSGKADHMLNIVRFVTYSSWLPENALVSIRILTAIMRQPNVNQQILGLLT
QSERIRNEIRQGFVECLESESVTFASTPQTSTDPSSDGNDPDQDVEDYATAADAASAVSV
ELQIKEAIVGLLQECLPQQSTPNLAHYLLGFELNKELRLTNLQQPGVMNFPSNCAKSLIT
LLDNALENSKSGKHSATAQERLIEHAYALLYSLCYNSRTSEVILRFLRSCNDFLCRHING
LPFANVKSPHVLNQMTGLLKCVAIELKLTSDKSQVSQFGNVCKILLGVVQNQPSETLPLE
LSHHYSTVNSSMLMSSVTGMEPGATVSRKAPESAKLLLCQLLDCLNFEIKSLDKPKWDYF
DNSLLQSLLQDCEIAVPGSALKLIDIKRLHDVLKDELNSVQTTIAAGQRAHILAEIETIL
MYALQLNSQRNLCASTVKFLEAWGQVTEVLFSVTPTMFVSLDVKQGLLVEIVQAVLSKVV
PNQVMPELANLASSTILLLMVNLRHCYSLKNGGDGAASGLNESTLMTSFGGSFAQNGVGQ
GAGRFSPKANTLSLRYILQNILEWILISGVGSQKLRINLYAALLNYMHIVKGNRDKSEQN
TESVRDEFYVSRLDKSLAAGRTHEVGGDESHAQIEMVVEIVQSFGDKLIDILCHDCTGGL
DICKMLALSCIDMLLDMDSMANVIQFISKRGYLSHLIDSLLKNDGKLCRILDNQPENMKA
LYVYESKMAMLSRIGSSHIGAELLLEERALSVLAGMKVFDLHPDFQVQNYSPLYPTSSSF
IPPIEARYQQILFPALNLCDVILSTLGQENHSAVTQVINFLLSHGDMIEIVLRAGTPFLN
IGLLRELAGITGLIARAANQEISSLITPNANQDIGAHLYRLQKLMLTLFPRFTLSDQTLK
ELNQNVLTNCSEREKAAHLKYFLQIAANLALYARNSISNHSVDHRTINVLFSPQISESVH
HRQVTGAALETSHSLNIVVIQLKTSVEYFNREKLSYESLVRQRNSLPSLSLDANVQIQHN
NLTERIADKQEELKRCVFITEHCLYLLWAHLDFFMLRAIPVNTLHFNLSYGADNYLSSQT
EVGWKITADDVAALKKTLIAIFNETFCKQLLATGQQASDARASDKGFIEALLRRIKRLIQ
FVPVK
NT seq 5778 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccgttttgtttgcagcaactccggacgatatgtggactccgttcaagcacctc
ttcaacagcatcgaatcgttcctggcggcgtccgggagtggagccagtttggatgcgctg
ctgcggaagcacaagcagaatttcacaacactgttgagaaatccgccgaagaatgggaag
agccgggaggcgattcgggtgggaattacggaggggattacgttgcccgagtttggacac
acgatcctgtcgaaggatctggtggacgagagcgtgataatttccgatatgtacgacttg
aatgagtacattgcgttggagttgctttgcacggcgcagcagcagatgccgaatcatccg
ggattgcctcgaggattggtggcggttttgctgtattacgacggccggaagtcgctggtg
gcgagtttgaaggagctgtttcaggcgcggtcgggagtcagttggtgcacggatgcaccg
cacgagataacgcagctgattacggcctacacggacggattggtggccgatggagtgctg
gacaagattgtggatttgctgggggagttggacgtgaccaaggagctggatgtgctgacg
acgaatagggccctggggccgccgaagcatcaccggcaggtgttggatttgttcgaggag
attcgggtgctgttggcgacctgtttgttcaattgggccgcgcagtgcggattgccgagg
gggacgacggtgaagctgatccggtatctggccaagtataagtcgacggtgtcgagcgga
gggattgataacgttacgctggcgctgcagatggcgttgatgtatggactggacatgagc
gtgattcagcggagggaggatggcgaggaagttgtgaagcgacttccgatggttaaagat
ccggaatttatcgaaacggtgatggatgcgatttcgtcgagctgggaatgcgagggattg
cggtcggtgtcgcttttcacttttggattggccattgctacgctgagattggctccacag
aacttgtactcaaatacagcgaagatcatcgatcaggatgagcttctggtggacgctgcg
atccaaggaagggtgtttgatttcatccactatactctgctggagaacgaagtgatcttc
cggacggaattctactaccggaggatgcacgtcttgttcacggacttcatcgagctgatg
cactcgaaggtgacggaactgagggctcgagcggacgaaacggccagaaccgtccaggcc
ttccagcagcaaggattggatccccctgccaatctgtgccggaattttgaggctctgctc
ctctccgttggaaagctctatcagaacgaccaaatgcggctaaatctgtcactggaatac
tggggaccgatggaagtggccgccaactatcagcgggcttcctcccggtcggtttgtctc
ttcaaattcatccgtctggcgggagaactgctgcctccaatcctattcattccatacctg
aagatgctcgccggattatcgagctgtcctcaatccgcccggaatgccttcaacttgttg
aagcaaggcggcggagcatccggatcgatggccaccatctcctgggaccacttcttcaac
tctttgttccgctactatcaaaatctccgccaggagcaaaaccctggaagcgaaaccgtc
taccgaaaccgagccctcagccgcaatatcaatccgcaggaaatcgccggcctccaagcg
gtcctccaggtgattcgagccgtggccacacacgacgaagtggcccgagtcgccctatgc
gaacaccccaactgggctccccttcatgtcctcctcggactgatcagctgctcggtcccc
atctccttgaaagcagaactcgtgcagactctggccgccctcggcaagagtaaagaaacc
gccttgcagctctggaacaacctggaagcttcccaggtcatcaccacgatccctaccacc
aaccccaccgaaaagtggcaaatcgccgagaagtgtctccgcttgttgaacgccttcgtc
cagcgctacactcccacccccgtcgacttcccctccccgacccaaaaccgtgaggaaaac
tccccgcccgggttccacattctgctccaaatcaacaccaagtcggacttcctccgtctt
ctcctgcacatcatcgacgaagcctgcaccctcttcgattcctacacgcccttccccggt
cgcaaacacctcgagaccacctgcctcttcgccctccaaatacttgaacgcgccctcgaa
actcaagaggacttcttcaacgcccacttctccgccaactgctccatcctcctggccgga
gccaacaagctcctcctcggaatgaacccccgcagcggcaaggcggaccacatgctcaac
atcgtccgcttcgtcacctacagctcctggctcccggagaacgccctcgtctccatccgg
atcctcacggccatcatgcgccagccaaacgtcaaccagcagatcctcggtctgctcacg
cagtccgagcgaatcaggaacgagatccgccagggcttcgtcgaatgcctcgaaagcgag
tcggtgacattcgcctccaccccccaaacttccacggatccttccagcgacggaaacgac
cccgatcaagacgtggaggattacgcgacggcggcggacgctgcctccgcggtcagcgtc
gagctccagatcaaggaagccatcgttgggttgctgcaggagtgtttgccgcagcagagt
acgcccaatctggcgcactatctgctagggttcgagctgaacaaggaactacggctgacg
aatctgcagcagccgggcgtgatgaattttccgagcaactgcgccaagtcgctgattacg
ctgctggataatgcgctggagaactccaaatccggcaagcactcggccaccgcccaggag
cgcctcatcgaacacgcctatgccctcctctactcgctatgctacaacagccgcacctcg
gaggtcatcctgcgtttcctgcgctcgtgcaacgacttcctctgccggcacatcaacggc
cttccgttcgccaacgtcaagagcccgcacgtcctgaaccagatgaccggcctgctcaaa
tgcgttgccatcgagctcaaactgacctcggacaaaagccaggtttcgcagttcggaaac
gtgtgcaagatcctgctgggcgtggtccagaatcaaccgagcgagacactgccgctggaa
ctgtcacaccactacagcaccgtcaactccagcatgctgatgagttccgtgacggggatg
gaaccgggggcgacggtgtcacgcaaggccccggaatcggcgaagttgctgctgtgtcag
ctactggactgcttgaactttgagatcaagtcgctggataagcccaagtgggactacttc
gacaactcgttgctgcagagtctgctgcaggattgtgagattgcggttcccggatcggca
ctgaagctgatcgatatcaagcgactgcatgacgtgttgaaggatgagctgaactcggtc
cagacgacgatcgccgccgggcagagggcgcacattttggcggagatcgagacgatcttg
atgtacgcgttgcagctgaacagccagaggaatttgtgtgcgtcgacggtgaagttcctg
gaggcctggggacaagtgacggaggtgctgttcagcgtaactcccacgatgttcgtttcg
ttagacgtcaagcagggactgctggtggagattgtgcaggcggttctcagcaaggtggtg
cccaatcaggtcatgccggagctggcgaatttggcgtcctcgacgatcttgctgttgatg
gtgaacctgaggcattgctattcgttgaagaatggaggggacggtgcggcatccgggttg
aacgagagcaccctgatgacttcgtttggtggcagtttcgcccagaatggcgttggacaa
ggggcgggacggttttcgccgaaggccaatacgttgagtttgaggtacatcttgcagaac
attttggagtggatcttgattagcggggtgggatctcagaaactgaggatcaatttgtac
gcggcgctgctgaattatatgcacattgttaagggtaatcgcgacaagagcgagcagaat
acggagtcggttcgggacgaattctacgtatcccgtttggataaaagtttggccgctgga
aggactcatgaagttgggggagacgaatcgcatgcccagatcgaaatggttgtggagatc
gtacaatcgttcggcgacaagttgatcgatatcctgtgccatgattgcaccggagggctg
gacatctgcaaaatgttggctttgtcctgcattgacatgctcctggatatggactcgatg
gccaacgtgattcagttcatatccaaacgtggatacttgtcgcacttgatcgatagtctg
cttaagaacgatggcaagctgtgcagaatcttggacaatcaaccggagaacatgaaagcc
ttgtacgtctatgaatcgaaaatggccatgctgagtcgtatcggaagttctcacatcgga
gcagagcttctcttggaagaaagagctctcagcgttctggctggaatgaaggtcttcgac
ctacacccggatttccaagtccagaactactctcccctctatccaacatcctcaagcttc
attcctccgatcgaagcccgctaccaacagatcttgttcccagcgttgaacctctgtgat
gtaattctgtccacgttaggccaagaaaaccactcggccgtcacccaagtcatcaacttc
ctactatcccacggagacatgatcgagatcgtactgcgcgcaggaactccgttccttaac
atcggcctcctacgggagctcgccggcatcactgggctgatcgcccgtgccgccaaccag
gaaatatccagcttgatcactccgaacgccaaccaagacatcggcgcacatctctaccgc
ctgcagaagctcatgctgacccttttccctcgcttcaccctctccgatcaaaccctgaaa
gaactgaaccagaacgtcctgaccaattgcagcgagcgggaaaaggccgctcacctgaag
tacttcctacagatcgccgccaacttggcactgtacgcccggaacagcatctccaaccac
tcggtcgatcaccgcacgatcaatgtgctcttttcgccgcagatcagcgaaagtgtccat
caccgacaggtcaccggagcagccctagagacgagccacagcctgaacatcgtggtcatt
caactgaagacctcggtcgagtacttcaaccgggagaagctatcgtacgagagtttggtg
cgccagcggaactcgctgcccagtctcagcttggatgctaatgttcaaattcaacacaac
aacctcacggagcggatagccgataagcaggaggagctgaagcgttgcgtcttcataacc
gaacactgtctgtacctcctgtgggcccacttggatttcttcatgttgcgtgcgatcccg
gtcaacacgttgcacttcaacctttcctacggagcagacaactacctctcgtcccagacg
gaagtcggctggaagatcaccgccgacgacgtggccgccctcaagaagaccctcatcgcc
atcttcaacgagacgttctgcaagcagctgctggccaccgggcagcaggcatcggacgcc
cgcgcctcggacaagggcttcatcgaggcgctgctccggcgaatcaagcgactgatccag
ttcgtgccggtcaagtga

DBGET integrated database retrieval system