KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010526Help
Entry
AaeL_AAEL010526   CDS       T01053                                 

Definition
(RefSeq) AAEL010526-PA
  KO
K14310  
nuclear pore complex protein Nup205
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL010526
Messenger RNA biogenesis [BR:aag03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     AaeL_AAEL010526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1925 aa AA seqDB search
MFTVLFAATPDDMWTPFKHLFNSIESFLAASGSGASLDALLRKHKQNFTTLLRNPPKNGK
SREAIRVGITEGITLPEFGHTILSKDLVDESVIISDMYDLNEYIALELLCTAQQQMPNHP
GLPRGLVAVLLYYDGRKSLVASLKELFQARSGVSWCTDAPHEITQLITAYTDGLVADGVL
DKIVDLLGELDVTKELDVLTTNRALGPPKHHRQVLDLFEEIRVLLATCLFNWAAQCGLPR
GTTVKLIRYLAKYKSTVSSGGIDNVTLALQMALMYGLDMSVIQRREDGEEVVKRLPMVKD
PEFIETVMDAISSSWECEGLRSVSLFTFGLAIATLRLAPQNLYSNTAKIIDQDELLVDAA
IQGRVFDFIHYTLLENEVIFRTEFYYRRMHVLFTDFIELMHSKVTELRARADETARTVQA
FQQQGLDPPANLCRNFEALLLSVGKLYQNDQMRLNLSLEYWGPMEVAANYQRASSRSVCL
FKFIRLAGELLPPILFIPYLKMLAGLSSCPQSARNAFNLLKQGGGASGSMATISWDHFFN
SLFRYYQNLRQEQNPGSETVYRNRALSRNINPQEIAGLQAVLQVIRAVATHDEVARVALC
EHPNWAPLHVLLGLISCSVPISLKAELVQTLAALGKSKETALQLWNNLEASQVITTIPTT
NPTEKWQIAEKCLRLLNAFVQRYTPTPVDFPSPTQNREENSPPGFHILLQINTKSDFLRL
LLHIIDEACTLFDSYTPFPGRKHLETTCLFALQILERALETQEDFFNAHFSANCSILLAG
ANKLLLGMNPRSGKADHMLNIVRFVTYSSWLPENALVSIRILTAIMRQPNVNQQILGLLT
QSERIRNEIRQGFVECLESESVTFASTPQTSTDPSSDGNDPDQDVEDYATAADAASAVSV
ELQIKEAIVGLLQECLPQQSTPNLAHYLLGFELNKELRLTNLQQPGVMNFPSNCAKSLIT
LLDNALENSKSGKHSATAQERLIEHAYALLYSLCYNSRTSEVILRFLRSCNDFLCRHING
LPFANVKSPHVLNQMTGLLKCVAIELKLTSDKSQVSQFGNVCKILLGVVQNQPSETLPLE
LSHHYSTVNSSMLMSSVTGMEPGATVSRKAPESAKLLLCQLLDCLNFEIKSLDKPKWDYF
DNSLLQSLLQDCEIAVPGSALKLIDIKRLHDVLKDELNSVQTTIAAGQRAHILAEIETIL
MYALQLNSQRNLCASTVKFLEAWGQVTEVLFSVTPTMFVSLDVKQGLLVEIVQAVLSKVV
PNQVMPELANLASSTILLLMVNLRHCYSLKNGGDGAASGLNESTLMTSFGGSFAQNGVGQ
GAGRFSPKANTLSLRYILQNILEWILISGVGSQKLRINLYAALLNYMHIVKGNRDKSEQN
TESVRDEFYVSRLDKSLAAGRTHEVGGDESHAQIEMVVEIVQSFGDKLIDILCHDCTGGL
DICKMLALSCIDMLLDMDSMANVIQFISKRGYLSHLIDSLLKNDGKLCRILDNQPENMKA
LYVYESKMAMLSRIGSSHIGAELLLEERALSVLAGMKVFDLHPDFQVQNYSPLYPTSSSF
IPPIEARYQQILFPALNLCDVILSTLGQENHSAVTQVINFLLSHGDMIEIVLRAGTPFLN
IGLLRELAGITGLIARAANQEISSLITPNANQDIGAHLYRLQKLMLTLFPRFTLSDQTLK
ELNQNVLTNCSEREKAAHLKYFLQIAANLALYARNSISNHSVDHRTINVLFSPQISESVH
HRQVTGAALETSHSLNIVVIQLKTSVEYFNREKLSYESLVRQRNSLPSLSLDANVQIQHN
NLTERIADKQEELKRCVFITEHCLYLLWAHLDFFMLRAIPVNTLHFNLSYGADNYLSSQT
EVGWKITADDVAALKKTLIAIFNETFCKQLLATGQQASDARASDKGFIEALLRRIKRLIQ
FVPVK
NT seq 5778 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccgttttgtttgcagcaactccggacgatatgtggactccgttcaagcacctc
ttcaacagcatcgaatcgttcctggcggcgtccgggagtggagccagtttggatgcgctg
ctgcggaagcacaagcagaatttcacaacactgttgagaaatccgccgaagaatgggaag
agccgggaggcgattcgggtgggaattacggaggggattacgttgcccgagtttggacac
acgatcctgtcgaaggatctggtggacgagagcgtgataatttccgatatgtacgacttg
aatgagtacattgcgttggagttgctttgcacggcgcagcagcagatgccgaatcatccg
ggattgcctcgaggattggtggcggttttgctgtattacgacggccggaagtcgctggtg
gcgagtttgaaggagctgtttcaggcgcggtcgggagtcagttggtgcacggatgcaccg
cacgagataacgcagctgattacggcctacacggacggattggtggccgatggagtgctg
gacaagattgtggatttgctgggggagttggacgtgaccaaggagctggatgtgctgacg
acgaatagggccctggggccgccgaagcatcaccggcaggtgttggatttgttcgaggag
attcgggtgctgttggcgacctgtttgttcaattgggccgcgcagtgcggattgccgagg
gggacgacggtgaagctgatccggtatctggccaagtataagtcgacggtgtcgagcgga
gggattgataacgttacgctggcgctgcagatggcgttgatgtatggactggacatgagc
gtgattcagcggagggaggatggcgaggaagttgtgaagcgacttccgatggttaaagat
ccggaatttatcgaaacggtgatggatgcgatttcgtcgagctgggaatgcgagggattg
cggtcggtgtcgcttttcacttttggattggccattgctacgctgagattggctccacag
aacttgtactcaaatacagcgaagatcatcgatcaggatgagcttctggtggacgctgcg
atccaaggaagggtgtttgatttcatccactatactctgctggagaacgaagtgatcttc
cggacggaattctactaccggaggatgcacgtcttgttcacggacttcatcgagctgatg
cactcgaaggtgacggaactgagggctcgagcggacgaaacggccagaaccgtccaggcc
ttccagcagcaaggattggatccccctgccaatctgtgccggaattttgaggctctgctc
ctctccgttggaaagctctatcagaacgaccaaatgcggctaaatctgtcactggaatac
tggggaccgatggaagtggccgccaactatcagcgggcttcctcccggtcggtttgtctc
ttcaaattcatccgtctggcgggagaactgctgcctccaatcctattcattccatacctg
aagatgctcgccggattatcgagctgtcctcaatccgcccggaatgccttcaacttgttg
aagcaaggcggcggagcatccggatcgatggccaccatctcctgggaccacttcttcaac
tctttgttccgctactatcaaaatctccgccaggagcaaaaccctggaagcgaaaccgtc
taccgaaaccgagccctcagccgcaatatcaatccgcaggaaatcgccggcctccaagcg
gtcctccaggtgattcgagccgtggccacacacgacgaagtggcccgagtcgccctatgc
gaacaccccaactgggctccccttcatgtcctcctcggactgatcagctgctcggtcccc
atctccttgaaagcagaactcgtgcagactctggccgccctcggcaagagtaaagaaacc
gccttgcagctctggaacaacctggaagcttcccaggtcatcaccacgatccctaccacc
aaccccaccgaaaagtggcaaatcgccgagaagtgtctccgcttgttgaacgccttcgtc
cagcgctacactcccacccccgtcgacttcccctccccgacccaaaaccgtgaggaaaac
tccccgcccgggttccacattctgctccaaatcaacaccaagtcggacttcctccgtctt
ctcctgcacatcatcgacgaagcctgcaccctcttcgattcctacacgcccttccccggt
cgcaaacacctcgagaccacctgcctcttcgccctccaaatacttgaacgcgccctcgaa
actcaagaggacttcttcaacgcccacttctccgccaactgctccatcctcctggccgga
gccaacaagctcctcctcggaatgaacccccgcagcggcaaggcggaccacatgctcaac
atcgtccgcttcgtcacctacagctcctggctcccggagaacgccctcgtctccatccgg
atcctcacggccatcatgcgccagccaaacgtcaaccagcagatcctcggtctgctcacg
cagtccgagcgaatcaggaacgagatccgccagggcttcgtcgaatgcctcgaaagcgag
tcggtgacattcgcctccaccccccaaacttccacggatccttccagcgacggaaacgac
cccgatcaagacgtggaggattacgcgacggcggcggacgctgcctccgcggtcagcgtc
gagctccagatcaaggaagccatcgttgggttgctgcaggagtgtttgccgcagcagagt
acgcccaatctggcgcactatctgctagggttcgagctgaacaaggaactacggctgacg
aatctgcagcagccgggcgtgatgaattttccgagcaactgcgccaagtcgctgattacg
ctgctggataatgcgctggagaactccaaatccggcaagcactcggccaccgcccaggag
cgcctcatcgaacacgcctatgccctcctctactcgctatgctacaacagccgcacctcg
gaggtcatcctgcgtttcctgcgctcgtgcaacgacttcctctgccggcacatcaacggc
cttccgttcgccaacgtcaagagcccgcacgtcctgaaccagatgaccggcctgctcaaa
tgcgttgccatcgagctcaaactgacctcggacaaaagccaggtttcgcagttcggaaac
gtgtgcaagatcctgctgggcgtggtccagaatcaaccgagcgagacactgccgctggaa
ctgtcacaccactacagcaccgtcaactccagcatgctgatgagttccgtgacggggatg
gaaccgggggcgacggtgtcacgcaaggccccggaatcggcgaagttgctgctgtgtcag
ctactggactgcttgaactttgagatcaagtcgctggataagcccaagtgggactacttc
gacaactcgttgctgcagagtctgctgcaggattgtgagattgcggttcccggatcggca
ctgaagctgatcgatatcaagcgactgcatgacgtgttgaaggatgagctgaactcggtc
cagacgacgatcgccgccgggcagagggcgcacattttggcggagatcgagacgatcttg
atgtacgcgttgcagctgaacagccagaggaatttgtgtgcgtcgacggtgaagttcctg
gaggcctggggacaagtgacggaggtgctgttcagcgtaactcccacgatgttcgtttcg
ttagacgtcaagcagggactgctggtggagattgtgcaggcggttctcagcaaggtggtg
cccaatcaggtcatgccggagctggcgaatttggcgtcctcgacgatcttgctgttgatg
gtgaacctgaggcattgctattcgttgaagaatggaggggacggtgcggcatccgggttg
aacgagagcaccctgatgacttcgtttggtggcagtttcgcccagaatggcgttggacaa
ggggcgggacggttttcgccgaaggccaatacgttgagtttgaggtacatcttgcagaac
attttggagtggatcttgattagcggggtgggatctcagaaactgaggatcaatttgtac
gcggcgctgctgaattatatgcacattgttaagggtaatcgcgacaagagcgagcagaat
acggagtcggttcgggacgaattctacgtatcccgtttggataaaagtttggccgctgga
aggactcatgaagttgggggagacgaatcgcatgcccagatcgaaatggttgtggagatc
gtacaatcgttcggcgacaagttgatcgatatcctgtgccatgattgcaccggagggctg
gacatctgcaaaatgttggctttgtcctgcattgacatgctcctggatatggactcgatg
gccaacgtgattcagttcatatccaaacgtggatacttgtcgcacttgatcgatagtctg
cttaagaacgatggcaagctgtgcagaatcttggacaatcaaccggagaacatgaaagcc
ttgtacgtctatgaatcgaaaatggccatgctgagtcgtatcggaagttctcacatcgga
gcagagcttctcttggaagaaagagctctcagcgttctggctggaatgaaggtcttcgac
ctacacccggatttccaagtccagaactactctcccctctatccaacatcctcaagcttc
attcctccgatcgaagcccgctaccaacagatcttgttcccagcgttgaacctctgtgat
gtaattctgtccacgttaggccaagaaaaccactcggccgtcacccaagtcatcaacttc
ctactatcccacggagacatgatcgagatcgtactgcgcgcaggaactccgttccttaac
atcggcctcctacgggagctcgccggcatcactgggctgatcgcccgtgccgccaaccag
gaaatatccagcttgatcactccgaacgccaaccaagacatcggcgcacatctctaccgc
ctgcagaagctcatgctgacccttttccctcgcttcaccctctccgatcaaaccctgaaa
gaactgaaccagaacgtcctgaccaattgcagcgagcgggaaaaggccgctcacctgaag
tacttcctacagatcgccgccaacttggcactgtacgcccggaacagcatctccaaccac
tcggtcgatcaccgcacgatcaatgtgctcttttcgccgcagatcagcgaaagtgtccat
caccgacaggtcaccggagcagccctagagacgagccacagcctgaacatcgtggtcatt
caactgaagacctcggtcgagtacttcaaccgggagaagctatcgtacgagagtttggtg
cgccagcggaactcgctgcccagtctcagcttggatgctaatgttcaaattcaacacaac
aacctcacggagcggatagccgataagcaggaggagctgaagcgttgcgtcttcataacc
gaacactgtctgtacctcctgtgggcccacttggatttcttcatgttgcgtgcgatcccg
gtcaacacgttgcacttcaacctttcctacggagcagacaactacctctcgtcccagacg
gaagtcggctggaagatcaccgccgacgacgtggccgccctcaagaagaccctcatcgcc
atcttcaacgagacgttctgcaagcagctgctggccaccgggcagcaggcatcggacgcc
cgcgcctcggacaagggcttcatcgaggcgctgctccggcgaatcaagcgactgatccag
ttcgtgccggtcaagtga

DBGET integrated database retrieval system