KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010578Help
Entry
AaeL_AAEL010578   CDS       T01053                                 

Definition
mixed-lineage leukemia protein, mll
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AaeL_AAEL010578
Enzymes [BR:aag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AaeL_AAEL010578
Transcription factors [BR:aag03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    AaeL_AAEL010578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 172 aa AA seqDB search
MLSEALLRKIKRRGSGSNLPMAMRYRTLKETSKESVGVYRSHIHGRGLFCNRDIEAGEMV
IEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDEHFVVDATMRGNAARFINHSCEPNCYS
KVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDVKIPCSCGSKKCRKYLN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcgaagctttattgaggaaaataaagagacgaggcagtggcagtaatctcccc
atggcgatgcgctatcgaacgctgaaagaaacgtccaaggaatcggtgggagtctatcgg
tcgcacatccatggccgcggtttgttctgcaaccgtgacatcgaagctggcgaaatggta
atcgaatacgccggtgagctgattcgttctaccctgacggacaaacgcgaacggtactac
gacagccggggcatcgggtgctacatgttcaaaatcgatgaacatttcgtcgtggacgca
acgatgcggggcaatgcagcacgtttcattaaccattcgtgtgagccaaactgctactcg
aaggtcgttgacatactgggccacaagcacatcatcatctttgcactccggcggatcgtc
cagggagaggagctaacgtacgattacaagtttcccttcgaggacgtcaaaatcccctgc
tcgtgtgggtcgaagaagtgtcgcaaatatttgaactag

DBGET integrated database retrieval system