KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010590Help
Entry
AaeL_AAEL010590   CDS       T01053                                 

Definition
aldose-1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AaeL_AAEL010590
   00052 Galactose metabolism
    AaeL_AAEL010590
Enzymes [BR:aag01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AaeL_AAEL010590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 436 aa AA seqDB search
MSNIASFESYGEPAPSSNKGSYVSDGSNRSGSVTVKTMDGSHHSEAQAVSLTVDGFGTVK
NPLSGEVQPVKRFTWTNENGMSVQVISYGAIITSIKVPGKNGAVDDVVLGFDNIPGYQGA
NNPYFGATVGRVANRIGGGRFTIDGVVYEVTKNFEGRHQLHGGKIGFDKFNWTSHVEGTV
VTLSHTNMDGHEGYPGTVLASVTYELKEDNQLVVKFQAVADKPTPVNLTNHSYFNLAGHN
TGHEEVYRHIISLNADRITETDEDSIPTGKFLCVGGTPYDLRIPRELGPAMSRTPGEGYD
NNFCITKGTEQGMTFTARVVHPHSGRVLEVYTDQPGVQLYTSNFMPDPNRNIRPKPINAA
DYYELTHLEPVVPSMATDLPIRGKGGAKYFKHGAFCLETQNYPDAVNHANFPNSVLVPGE
TFSHEVVYKFGLLEEN
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgcatcgtttgaatcctacggagaaccggcgcccagctccaacaaaggt
tcgtacgtgagtgatggaagcaatcgatccggatcggtaacggtgaaaactatggacggg
tcgcaccattcggaggcccaggctgtcagcctcacggtggacggattcggaacggtgaaa
aatccgctgagtggtgaagtgcaaccggtgaagcggttcacatggacgaacgaaaacggt
atgtcggttcaggtgatatcctacggagccatcatcacctcaatcaaggttcccggaaag
aatggcgcggtggacgacgtggttctaggattcgataacattcccggctatcaaggagca
aataatccgtactttggggcgaccgtgggtcgggtggccaatcgcatcggaggcggtcgg
ttcaccatcgatggagtggtctatgaggtcacgaagaacttcgaaggtcgccatcagctg
cacggtggcaaaatcggattcgacaagttcaactggacgtcgcatgtggagggtacggtt
gttacattgagccacacgaacatggatgggcacgagggataccccggaacggtgctggct
tcggtgacctacgagctgaaggaggacaatcagctcgtggtcaaatttcaagcggtggca
gacaagcccactccggtcaatctgacgaaccactcgtatttcaatctggctgggcataac
acgggccacgaggaggtgtaccgtcacatcatttcgctgaacgccgaccgcattacggaa
acggacgaggactccatcccgacgggcaagttcctttgcgtcggcggaacgccatacgat
ctgagaattcctcgggagctcggtccggccatgtcgcgaactccgggcgagggctacgat
aacaacttctgcatcaccaagggcaccgagcagggtatgaccttcaccgctcgggtcgtg
catccgcattcgggacgcgtgctggaggtttacaccgatcaaccgggcgtccagctgtac
accagcaactttatgcccgatccgaatcgcaatatccgcccgaagccgattaacgccgcg
gactactacgaattgacgcatctggaaccggtggtgccctcgatggcgaccgatctgccc
atccggggtaagggcggtgccaagtacttcaagcacggtgccttctgtctggagacgcaa
aactaccccgatgcggtcaaccatgccaatttcccgaactcggtgctggtcccgggggag
accttctcgcacgaggtggtgtacaagtttggccttcttgaggagaactga

DBGET integrated database retrieval system