KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010729Help
Entry
AaeL_AAEL010729   CDS       T01053                                 

Definition
myst histone acetyltransferase
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 647 aa AA seqDB search
MYSSSTYRFVLTLQSTSSTESSTASSSDSSSSDSSSSGSDSGSSSSESDSSSSQEPTTTR
MGTNNSNANGRQKLLKIDAEKVAPQKQAAAKQQKLSKSSISSSDDDLLADSKPHEPKGRR
TSSSSSVGNAGTGSAGKCPTALCGSATQPPKEQTASGAQSSGGTTAQQQQRGRGRPRKTP
AAASSGPVAKPIAQVKPQVSAAPAKAAASTAPKPQPSQAQKQEEDISSATTSSTDSTTSG
SSDSDSDSSEDSSPSQSAAAQQLKKSNSGVKRPLERTPQKSEVKEGVTDSEGEKGDSNKQ
TRKLTRSSSTRKSKHLIGKNASETDSDADSVKRSASKSPVKKAPIVATKGKAKNSSKKKD
AVVKELLIEEPEPVENRCPLLHCDSTGHLGGQFERHFTLEACPMFHNMSAQQTREFLQER
KRREEDRKKAVPVYENSKKVQTPEQKIYMQKIRDMRAKFKPNPHPVEKPRPMSERLENEI
DLEPRLDGIVPDYDLQLFREAQAAASESFENEVREMVTGKGTRYISMGRNCMQVWYQSPY
PDDVARLPKLYLCEFCLRYQKSEVGMKRHAAKCVWRHPPGDEIYRKGKLGVWQVDGKRHK
QYCQHLCLLAKFFLDHKTLYYDVEPFLFYVMTLADSDGCHTVGYFSK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtatagttcaagtacttaccgctttgtgttaactttgcagtccacaagcagcacggaa
tccagcaccgccagctcatcggattcgagttccagcgatagtagctcgagtggaagcgat
tccggaagctccagcagcgaaagtgattcctctagctctcaggagccgaccactactcgc
atgggcacgaataactctaatgctaatggtaggcagaaacttctaaagatagacgctgag
aaagtagcgcctcaaaaacaggcggccgccaagcagcaaaagctttccaagagttcgatt
tcttcaagtgacgatgacctgctggctgatagtaagcctcacgaaccgaaaggtcgccgt
acgtcgagttctagttcggtgggaaacgctggaacgggatctgctggtaagtgtccaaca
gcgctctgtggatcagcaacacagccccccaaagagcagaccgcttcaggggctcaatcg
tcaggtggaacaacagcccaacagcagcaacgaggtcgtggccgtccacgaaaaactccg
gccgccgcttcctccggtccagtagcgaaaccaatcgcacaagtcaaaccccaagtctcg
gcagcaccagcaaaagcggccgcttcaacggcaccgaagccacagccttcacaagcccag
aaacaagaagaggacatctcttcggccactacttcctctacggattcaactacttccggg
tcatcggattcggattcggactcatcggaggattcgtctccatcgcaatctgctgctgct
cagcagctgaagaagagcaacagtggcgtgaagcgtcctctggaacgcaccccacaaaag
tccgaggtcaaggaaggtgttaccgattctgagggcgaaaaaggggactcgaataagcaa
actcggaagctgactcggtcgtctagcactcgcaaatccaaacatcttattggaaagaat
gcctcagagacggattcggatgcggacagtgtcaaaaggtctgcctctaagagccctgtg
aagaaggcgccaattgtggcgaccaagggcaaagctaagaacagcagcaagaaaaaggat
gccgtggtaaaggaactgctcattgaggaaccggaaccggtggagaatcgttgcccattg
ctgcattgcgattcaacaggtcatttgggtggtcaattcgagcggcatttcaccctcgaa
gcttgccccatgttccacaatatgtccgctcagcagaccagagagtttcttcaagaacga
aaacgccgcgaagaggaccgtaaaaaagccgttccggtctacgaaaactccaagaaggtc
caaacgccggagcagaaaatctacatgcaaaaaattcgggacatgcgcgccaaatttaag
cccaatccgcatccggtggaaaagccccgaccgatgtccgaacggttggagaacgaaatc
gatctggaacctcggctggatgggatcgttcccgattacgacctgcagttgttccgcgag
gctcaagctgcggccagtgaaagtttcgaaaacgaagtaagagaaatggtcaccgggaag
ggcacccgctacatctcgatgggacgtaattgcatgcaggtgtggtatcagagtccctac
ccggacgatgtcgcccggctaccgaagctgtacttgtgtgagttctgtttgcggtatcaa
aagtcggaggtcggcatgaagaggcatgcagcgaagtgcgtttggagacatccaccgggc
gatgagatttaccgcaagggtaagctcggcgtgtggcaggtggatggcaaacggcacaaa
cagtactgccagcacttgtgtctgttggccaagtttttcctcgaccacaaaacgttgtac
tacgatgtggaaccgttcctgttctacgtgatgacactggccgacagcgacggatgtcac
actgtgggatacttcagcaag

DBGET integrated database retrieval system