KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010764Help
Entry
AaeL_AAEL010764   CDS       T01053                                 

Definition
aldehyde dehydrogenase
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AaeL_AAEL010764
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     AaeL_AAEL010764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 932 aa AA seqDB search
MSSGSECNGVKTNGYFNGNGHPEDLKIAIIGQSNFAAEVLEVLLEHHHIVVGVFTIADKG
SREDILATTARQLNIPVFKISAWRRKGVPIPEVLEKYKSVGANLNVLPFCSQFIPMEVID
GAKFGSICYHPSILPRHRGASAISWTLIEGDDTAGFSIFWADDGLDTGPILLQRQCPVYG
DDTLDTLYKRFLYPEGVTAMVEAVNMIADGTAPKITQTEIGATYDPALFREENQFIDLNQ
SAERIFNFIRGLDSVPGALAVIIGDDGSECPVRLHGASLCGPAMLDNAKRVNFKGSAGPA
FVDRDGIFITASDGQLVKVKRVKKGSKMIQASQWFTQAGKKVIPLELNAREVEMEEILKG
IWKSILKVEIEAETDFFACGAGSMDVVRLVEEVKDALEIPLENENLFMAPSFQEFLNEVI
SRTRNGTSQESSGPDYESVVLRENKKTISVPVQMFVNGRFIDAENKKTLDIINPTTEQVI
CKVAAASASDVDYAIRCAHDAFKGVWSQVSARERGQMMYKLADLMEQYKEELATIESVDS
GAVYTLALKTHVGMSIDAWRYYAGWTDKIEGSTIPVNPAKPNNVLTFTKREPVGVCGLIT
PWNYPLMMLSWKMAACIAAGNTVVIKPAQVCPLTALKFAELSVKAGFPPGVINVVTGAGS
VTGQAISEHPLVRKLGFTGSTPIGKKIMASCAESNIKKCSMELGGKSPLIIFADCDMDKA
VRLGMSSVFFNKGENCIAAGRLFVEHKIHDEFVRKVVKNIKTMTIGDPLNRGTAHGPQNH
KAHMDKLVEYCQIGVKEGAKLVYGGKRVPNMKGWFFEPTVFTNVQDHMFIAKEESFGPIM
VVSKFHSSDFDALVQRANATEYGLASGVFTNDIRKAMLFADKVEAGTVFVNTYNKTDVAA
PFGGFKQSGFGKDLGQEALNEYLKTKCVTIEY
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgagctccggaagtgaatgcaatggtgtaaagacaaatggatatttcaacggaaacggt
cacccagaggacctcaaaatagcaatcatcggtcagagcaactttgcagccgaagttctg
gaagtcctactagagcatcaccacattgtggtcggagtgttcaccattgccgacaaggga
agccgcgaggacatccttgccacgactgcccggcaacttaacataccggttttcaagatt
tcggcatggcgacgcaagggtgttcccattccggaagtgctggagaagtacaagtcggtc
ggagcgaacttgaacgtgctgccattctgcagccagttcataccaatggaggtgattgat
ggagccaaatttggcagcatttgctatcatccgtcgatattgcccagacatcgtggagcg
agtgccatttcatggactttgatcgaaggggatgatacggccgggttctcgatcttctgg
gctgacgatggactggataccggaccaattctgctgcagagacaatgtccggtgtacgga
gatgatacactggacacattatacaagagattcctgtatccggaaggtgtcacagcaatg
gtggaagcagtgaatatgattgcggatgggactgcaccgaagattacgcagactgagatc
ggggccacctacgatcctgcgctattccgtgaagagaatcagtttattgatttgaatcaa
tcggcggagaggatttttaacttcatcagagggttggattcagtgcctggggcattggcg
gtaattatcggggatgatggaagtgagtgtcccgtgcgattgcacggagcatctttatgt
ggcccagccatgctcgataacgctaaacgagtgaacttcaagggatcagcaggtccagct
tttgtggatcgcgatggaatttttatcaccgcatcggacggacagttggtgaaggtgaaa
cgtgtgaaaaaaggaagcaagatgatccaggctagtcaatggtttacccaggcgggtaag
aaggttataccattagagttgaatgcacgagaagttgagatggaggaaatactcaaagga
atttggaagtccatcttgaaggtggaaatagaagcggaaacagacttcttcgcctgtggt
gccggttccatggatgtcgttcgcttagtggaagaagtcaaagatgcattggagatcccg
ttagaaaacgaaaatcttttcatggcacctagcttccaggaatttctgaacgaagtaata
agtagaacaaggaatggaacaagccaggaaagttccggaccggattatgaatcggtagtt
ttgagagagaacaagaagacaatttccgtaccagtgcagatgtttgtaaatggtaggttc
atcgacgcagagaacaaaaagactctggatatcatcaaccctacgacggagcaagtaatc
tgtaaggtcgctgcagcatccgcgtcagatgtggattacgctataagatgtgctcatgac
gctttcaagggcgtttggagtcaagtatctgccagagagcgtgggcaaatgatgtacaaa
ctggctgaccttatggaacagtacaaggaagaattggcaaccattgaatccgttgactca
ggtgcagtatacaccctggctttgaaaactcacgtgggcatgtcgattgacgcgtggcgt
tattacgcgggatggacggataagatcgaaggatcgacaattcccgttaatccagctaaa
ccaaacaacgtactcaccttcaccaagcgagaaccggttggagtttgtggattgatcacc
ccttggaactatcccctgatgatgctctcgtggaaaatggctgcctgcattgctgctggc
aacactgtagtaatcaaacctgcccaagtttgtcctttaactgcattgaagtttgcggaa
ctctcggtgaaagctggattcccaccgggtgtaatcaacgtagttacgggagctggatct
gtcaccggccaagccatctccgaacatcccctggtacgaaaacttggctttactggatca
acacctattggcaaaaaaattatggcctcatgcgccgaatcgaatatcaaaaaatgctca
atggaacttggtggcaaaagtccactgataattttcgctgattgtgacatggataaggcc
gttcgattgggaatgtcatccgtgttcttcaacaaaggtgaaaactgcatagctgctgga
cggctgtttgtagagcacaagattcacgacgaatttgtgcgaaaagtagtgaaaaacatc
aaaactatgaccataggggatccgctaaatcgaggaacagctcatggtccacagaatcac
aaagctcacatggacaagctggtagagtattgccagattggagtaaaggaaggggctaag
cttgtctatggaggaaaacgagtgcccaacatgaagggttggttcttcgagccgactgtc
ttcaccaatgtgcaggatcacatgttcatagcaaaagaagaatctttcgggcctatcatg
gtcgtctcaaagttccacagcagtgattttgacgcattggttcagagggctaacgctaca
gaatacggtcttgccagcggagtgttcaccaatgatatccggaaagcaatgctgtttgcc
gataaagttgaagctggaaccgtctttgtcaatacgtacaacaagacagacgttgctgct
ccttttggagggttcaaacaaagcggatttggaaaggatttaggccaagaagcactgaac
gaatatctcaaaaccaaatgtgtgaccattgagtattga

DBGET integrated database retrieval system