KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL010856Help
Entry
AaeL_AAEL010856   CDS       T01053                                 

Definition
dopamine beta hydroxylase
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AaeL_AAEL010856
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     AaeL_AAEL010856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 593 aa AA seqDB search
MGAHISATQIHTLNLDNSLKLTWMMDWYKKEVLFHVQNTFHHGRYKFFALGFSPRGELKR
TDLCIFTTSAGGAYRQALDTYTSRDFNRIYVDSEQNCDVMRIDDNSVAFRRKFDSCDPQD
VSIHGGTMYVVWLRGKKQLDFGKNWTVMPTVGKADRGVLPVQILRADAITIPEAKSAVKR
VEILLDKAEIPAVETTYWCKVQRLEEWLTKKKHHIVQFEPVITHEHVVHHMEVFQCVADP
GTEIPLYEGSCSDLPAEAKICNKVMALWAMGAGPFTYPHETGLPIGGEGFNPYIRLEVHF
NNPDLKKGIVDSSGMRINVVSKLRKYDAAIMELGLEYTDKMAIPPGQVAFPLTGYCIAEC
TKVALPSGGIKIFGSQLHTHLRGVRVLTRHFRKGVELPEVNRDDFYSHHYQEIRQLRYRP
KVLPGDALMTTCYYDTRGYETATLGGFSISDEMCVNYIHYYPATELELCKSAISEKSLYN
YFKYMKEVEKQPVSPAGARSDNYHSIHWTKTRSDQLFEYYLEEPLSMQCNRSDGFRFEGY
DWEGAPITEFSPPRSTLRANCDIPPELRWFKPLEVGHCDVFGECIYEDEKIKE
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcacacatatctgcaacccaaatccacacgctgaacttggataacagcctcaaa
ctaacatggatgatggattggtacaaaaaagaagttctattccacgtgcagaacaccttt
caccacggtcgctacaaattcttcgccctcggattctcgccaaggggcgagctcaaacga
accgacttgtgtatcttcacgaccagcgccggtggcgcctatcggcaggccctcgacacc
tacacctcgcgggatttcaaccggatctacgtggacagcgagcagaactgcgacgtcatg
cggatcgacgacaactcggttgccttccggcggaagttcgacagctgcgatccgcaggat
gtgagcattcacggtgggactatgtacgtggtttggctgcgggggaagaagcagttggac
tttgggaagaactggaccgtgatgccaacggtggggaaggccgatcgaggcgtgctgcct
gtgcagattttgagggcggacgccataacgattccggaggcgaagtccgcggtgaagcgc
gtggagattctgctagataaggccgagattccggcggtggaaacgacgtattggtgcaag
gttcaacggctggaggaatggctgacgaagaagaagcatcacatagtgcagttcgagccg
gtcataacgcacgagcacgtcgttcatcacatggaggtgtttcagtgcgtagcagatcct
gggacagagatacctttgtacgagggtagctgttctgatttgccggcggaagcgaagatc
tgcaacaaggtgatggcactgtgggcgatgggagcggggccgttcacctatccgcacgaa
acgggacttccgattggcggggagggtttcaatccttacataaggttggaggtgcacttc
aacaatccggacttgaagaaagggatcgtggatagctcaggaatgcggatcaacgtggtg
tccaagttgagaaagtacgacgcggcgattatggagctggggttggagtacacggacaag
atggccattcctccgggacaggtggcgtttccgctgactgggtattgtatagcggagtgt
acgaaggtggcactgccatctggcggaattaagatcttcgggtcccaactacatacgcac
ctgaggggagttcgggttttgacgaggcacttccgaaagggagtcgagttgcccgaggtc
aaccgggatgatttctactcgcatcactaccaggagatacgacagttgaggtatcgcccg
aaggttcttccgggtgatgctctgatgacgacgtgctactacgatacccgaggctacgag
acggccactctcggtggattctcgatcagcgatgagatgtgcgtgaattacattcactac
tatccggcgacggagttggagctgtgcaagagcgccatatcggagaaatcgttgtacaac
tatttcaaatatatgaaagaagtggagaaacaaccggtgagccctgccggagcgcgctcc
gataactaccactcgatccactggaccaaaacccgctccgatcagctgttcgagtactac
ctggaggaacccctgagcatgcagtgcaaccgatcggatggtttccgcttcgagggctac
gactgggagggagcccccataaccgagttcagtccgccccgaagcactctccgggccaat
tgcgacatcccgccggaactgcgatggttcaaaccgctggaagtcggacactgcgacgtc
ttcggggaatgcatttacgaggacgaaaaaatcaaggagtaa

DBGET integrated database retrieval system